Welcome to TradeChina
RELATED CATEGORIES:
2020 Hot Sale small capacity double stainless steel vacuum insulated baby water bottle kidsUSD $ 5.50 - 6.50
>=100 Piece
Meo Food Co., Ltd.
BPA Free 60g & 30g Customized Logo Sticker Label Portable Protein Container Supplement Protein Powder Funnel With KeychainUSD $ 0.79 - 1.01
>=1000 Piece
Meo Food Co., Ltd.
C011 Factory Supply Portable Small Travel Mugs Stainless Steel Water Bottles BulkUSD $ 3.00 - 4.50
>=100 Piece
Meo Food Co., Ltd.
400ml BPA Free Environmental Eco friendly Degradable Wheat small Protein Shaker Water Bottle with straw For Sports GymUSD $ 0.98 - 1.10
>=1000 Piece
Meo Food Co., Ltd.
1000ml transparent drinking milk carton water bottle plastic kawai shapeUSD $ 2.00 - 2.40
>=2 piec
Meo Food Co., Ltd.
Zogift Factory promotion New design Transparent Portable water bottle for chinese supplierUSD $ 0.54 - 0.71
>=100 Piece
Meo Food Co., Ltd.
supermarkets decorative yoghurt wine coffee teacup ice creams mineral water milk coke resin miniature bottleUSD $ 0.01 - 0.20
>=20 Piece
Meo Food Co., Ltd.
Wholesale Customized Creative Korean Mini cute glass fresh simple portable small water cupUSD $ 2.97 - 3.69
>=2 Piece
Meo Food Co., Ltd.
Fangjuu Bottom Price Latest Design Portable Plastic Tea Cup Pink Iced Cartoon Plastic Water BottleUSD $ 1.97 - 2.95
>=10 Piece
Meo Food Co., Ltd.
Fangjuu Wholesale New Design Outdoor Plastic Tea Cup Silicone Lid Cute Painted Plastic Water BottleUSD $ 2.97 - 3.76
>=10 piec
Meo Food Co., Ltd.
cake craft portable plastic 18ml small plastic bottle spray powderUSD $ 0.50 - 0.80
>=5000 Piece
Meo household Co.LTD
Custom Made Square Shape Small Glass Bottle With Pump Colorful Car Perfume BottlesUSD $ 0.06 - 0.13
>=50000 Piece
Meo household Co.LTD
Mini Sisal Trees Artificial Small Christmas Trees Bottle Brush Brown Wood Table Top Tree Craft for Christmas DecorationUSD $ 0.52 - 1.07
>=2 Piece
Meo Food Co., Ltd.
30ml 50ml 60ml 80ml 120ml 160ml 240ml plastic pharmaceutical medicine capsule vial pill bottleUSD $ 0.05 - 0.09
>=500 Piece
Meo household Co.LTD
60ML bubble toys plastic summer outdoor bubble bottleUSD $ 0.09 - 0.19
>=30000 Piece
Meo Food Co., Ltd.
1325 100w wholesale liaocheng best sale wood craft cutting and ruber fiber stamp carving machine for mdf plastic jewelry sheetUSD $ 3,636.00 - 4,242.00
>=1 Set
Meo Textile Clothing Co.LTD
In stock plastic white small 2oz food grade squeeze bottle and red tip capsUSD $ 0.02 - 0.04
>=2000 Piece
Meo household Co.LTD
Small Beer Bottle Bottling Craft Beer Brewery Production Line Filling Plant Beer EquipmentUSD $ 32,500.00 - 52,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Small Craft Beer Filling Machine Counter Pressure Bottle Filler For Glass BottleUSD $ 18,000.00 - 40,000.00
>=1 Unit
Meo Textile Clothing Co.LTD
Wholesale Automatic Hot for walking portable plastic travel recycling dispense 350ml 550ml Pet dog water bottleUSD $ 3.60 - 4.40
>=20 Yard
Meo Food Co., Ltd.
Hot sell walking portable plastic travel recycling dispenser 300ml Pet dog water bottleUSD $ 3.99 - 4.62
>=100 piec
Meo Food Co., Ltd.
Yoyo Small Refillable Liquid Containers Portable Travel Bottles Set with Retractable Reel ClipUSD $ 0.69 - 0.99
>=50 Unit
Meo Electronic Technology Co.LTD
Small-Caliber Glass Bottle Bayonet Small Vial Pendant with Cork Plastic LidsUSD $ 0.01 - 0.04
>=3000 Piece
Meo household Co.LTD
High technology beer glass bottle b filler plant for small beer filling machine /1000BPH Craft Beer Glass bottle Filling MachineUSD $ 19,000.00 - 21,000.00
>=1 Set
Meo Textile Clothing Co.LTD
MUB 1 ml glass bottles of perfume small sample perfume bottle , vial bottle with plastic tubeUSD $ 0.01 - 0.03
>=10000 Piece
Meo household Co.LTD
Wholesale Clear Transparent Empty Mini Small 2oz 4oz 20ml 30ml 50ml 60ml 100ml Perfume Fine Mist pressure spray bottleUSD $ 0.20 - 0.32
>=1000 piec
Meo Food Co., Ltd.
Plastic bottle recycle fiber felt modern children small rectangle dining tables and desks for living roomUSD $ 17.00 - 18.30
>=200 piec
Meo Food Co., Ltd.
Reusable Baguette bread Bag Premium Unique Made from Recycled Plastic Bottles Freezer Safe Food Storage with Double LiningUSD $ 1.60 - 2.00
>=1000 Piece
Meo Electronic Technology Co.LTD
Milkshake Protein Shaker Ball For Small Bottle,Food Grade Stainless Steel Wire Mixer Mixing Ball For Small ShakerUSD $ 0.10 - 0.60
>=50 piec
Meo Textile Clothing Co.LTD
Gift Box with Ribbon Closure Box for Gift Craft Birthday Gifts for Husband Banknote Security Custom Silver Jewelry Baby ShoeUSD $ 3.72 - 3.72
>=2 Piece
Meo household Co.LTD
Cheap waterproof ice bag wine eco friendly transparent plastic reusable pvc wine bottle gift bagUSD $ 0.15 - 0.50
>=1000 Piece
Meo Electronic Technology Co.LTD
NEW high quality beer canning avoiding bubbles low price small beer can bottle filling machineUSD $ 6,000.00 - 25,000.00
>=1 Set
Meo Textile Clothing Co.LTD
3m factory price indoor artificial small bottle Coconut palm treeUSD $ 138.00 - 155.00
>=3 piec
Meo Food Co., Ltd.
small beer champagne drifting bottle plastic candy boxUSD $ 0.45 - 0.45
>=5000 Piece
Meo household Co.LTD
6-6-1 Glass Bottle Craft Beer Filling Machine / Small Scale Brew Bottling PlantUSD $ 17,000.00 - 18,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Small DIY Christmas Tree Pine Tree Mini Sisal Bottle Brush Christmas Tree Santa Snow Frost Village House Five SizeUSD $ 2.20 - 2.50
>=100 piec
Meo Food Co., Ltd.
Chinese Feng Shui Bronze Bell with Plastic Elephant & Baby Car Rear View Mirror Decor Patio Balcony Yard Buddha Lucky HangingUSD $ 1.29 - 1.93
>=12 piec
Meo Food Co., Ltd.
30 ml 50 ml small paper jar Packaging for cosmetic plastic jar paper tube packagingUSD $ 0.90 - 1.20
>=1000 piec
Meo household Co.LTD
Screw Top CLEAR Lid Pots/Jars - Beads, Glitter, Nail Art, CRAFT storage small containerUSD $ 0.15 - 0.35
>=500 Piece
Meo household Co.LTD
Small Jar Resin Molds with Lid Silicone Epoxy Casting Mold for Small Bottle DIY Mini Jewelry Container Storage Trinket BoxUSD $ 1.30 - 1.80
>=500 piec
Meo Food Co., Ltd.
Kenya agent nonmetal products crystal wood bottle plexiglass 1390 1610 500w lift table small laser engraving machineUSD $ 2,000.00 - 4,500.00
>=1 Set
Meo Textile Clothing Co.LTD
small 6040 50w co2 laser tube laser cutter leather craft engraving cutting machine Wine Bottle Cylinder Wood Co2 Laser EngravingUSD $ 1,000.00 - 2,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Factory direct sale cheap price craft small bead alphabet recyclable plastic beads,wholesale high quality colorful plastic beadsUSD $ 2.00 - 2.00
>=500 Piece
Meo Electronic Technology Co.LTD
Multipurpose Small Plastic Clips Colorful Cloth Clips for Sewing Patchwork Crafts With A Jar PackingUSD $ 0.03 - 0.05
>=20 Piece
Meo household Co.LTD
Clear Biodegradable Mini Pet Plastic Juice Bottle Cold Press Coffee Drinking 100ml 200ml 250ml 350 ml Plastic Bottle For JuiceUSD $ 0.35 - 0.80
>=50 Piece
Meo household Co.LTD
1 or 2 g powder small mini gold transparent acrylic 1 gallon plastic bottle for health care product packagingUSD $ 0.20 - 0.20
>=1000 piec
Meo household Co.LTD
4.2m factory price indoor outdoor artificial small bottle Coconut palm treeUSD $ 300.00 - 310.00
>=3 piec
Meo Food Co., Ltd.
0.5g saffron bottle small hexagon vial pigment bottlesUSD $ 0.15 - 0.15
>=1000 Piece
Meo household Co.LTDRelated Searches:
plasticcanvasheartshapeplasticcanvasnearmecraftstringplasticrecycledplasticweavingplasticanimalcraftsplasticcanvaskitsplasticcanvasanimalsetsyplasticcanvasbucillaplasticcanvaskitscraftswithplasticwaterbottlesplasticcanvasyarncrossstitchtissueboxcovereasycraftwithplasticbottlesplasticcanvascraftstomakeplasticboxcraftplasticcanvaseasterboyeplasticcrochethooksplasticcanvaswaterbottlepiggybankcraftdariceplasticcanvasdiyplasticbottleartplasticbottlecapartplasticbottlebirdfeedercraftchristmasdecorationswithplasticbottlesplasticbottlecraftsadultsplasticlanyardcraftplasticcanvasprojectsplasticbottleweavingusingyarnplasticstrawweavingplasticcanvaschristmas