Welcome to TradeChina
RELATED CATEGORIES:
Low Price Colorful Easy Clean Eco Friendly Bpa Free Plastic Clear Drinking Water Bottle For KidsUSD $ 4.30 - 5.80
>=100 piec
Meo Food Co., Ltd.
Best Sale Stylish Outdoor Sports Drink Easy Drink ware Plastic Water BottleUSD $ 0.99 - 1.72
>=2 Piece
Meo Food Co., Ltd.
30 OZ stainless steel tumbler high quality vacuum metal double wall insulated beer mug 100% BPA freeUSD $ 2.30 - 2.45
>=1000 Piece
Meo Food Co., Ltd.
1 gallon unbreakable Plastic drinking water jug for gym fitness outdoor exercise easy to carryUSD $ 2.45 - 2.60
>=1000 Piece
Meo Food Co., Ltd.
Collapsible Water Bottle, 21 oz Food Grade Silicone Foldable with Leak Proof Twist Cap and BPA Free Easy to Enjoy Outdoor TravelUSD $ 3.08 - 4.89
>=100 Piece
Meo Food Co., Ltd.
Outdoor Sports Water Bottle 21oz Plastic Easy To Grab Squeeze Water BottleUSD $ 0.67 - 0.94
>=50 Piece
Meo Food Co., Ltd.
cute newest pocket water bottles high quality borosilicate glass bpa free easy carry mini bottle 150ml hold snacksUSD $ 1.15 - 1.70
>=10 Piece
Meo Food Co., Ltd.
Seaygift custom BPA Free easy carrying multicolor sport water drinking mug biodegradable plastic wheat straw water bottleUSD $ 0.10 - 0.90
>=100 Piece
Meo Food Co., Ltd.
Stocked food grade unique easy carrying custom logo hockey water bottle with bamboo capUSD $ 1.96 - 4.35
>=500 Piece
Meo Food Co., Ltd.
Colorful Gym Sports Plastic, Shaker Bottle Protein Mixing Ball Water Bottles/USD $ 0.59 - 0.97
>=50 Piece
Meo Food Co., Ltd.
Fruit Infuser Water Bottle Flip Lid Fill The Infuser With The Sliced Fruit Or Vegetable Easy To Use Lemon Strawberry Orange CupUSD $ 1.20 - 1.50
>=100 piec
Meo Food Co., Ltd.
OEM Custom silicone travel set bottles soft touch cosmetic bottleUSD $ 0.65 - 0.65
>=50 piec
Meo household Co.LTD
Best price SY118F wholesale 650ml BPA free plastic slush yard body shape bottle with lidUSD $ 0.80 - 1.00
>=5000 Piece
Meo household Co.LTD
Writer Bottles 6 Easy Squeeze Applicator Bottles 3 each Cookie Cutters and Cake Decorating Food Coloring and Royal Icing SupplieUSD $ 1.00 - 1.00
>=100 Set
Meo household Co.LTD
New Fashion Gold/Silver/Pink Crown Plastic Package Bottle Beauty Cream JarUSD $ 0.46 - 0.60
>=3000 Piece
Meo household Co.LTD
plastic Jam ketchup sauce squeeze bottle with best factory priceUSD $ 1.20 - 2.60
>=1000 Piece
Meo household Co.LTD
China manufacturers wholesale SY631A 300ml plastic cartoon animal shaped bottle with strawUSD $ 0.80 - 1.00
>=5000 Piece
Meo household Co.LTD
In stock plastic white plastic easy hair oil squeeze bottle 2oz with twist top capUSD $ 0.02 - 0.04
>=2000 Piece
Meo household Co.LTD
ALL IN Cheap Plastic Homebrew Bottle Manual Filling Food Grade Plastic Tube Filling Craft Beer Bottle Manual FillerUSD $ 1.69 - 2.39
>=5 Piece
Meo Textile Clothing Co.LTD
Manual Carbonated Counter Pressure Craft Beer Soda Rinsing Filling Bottling machine with Crown CoverUSD $ 1,800.00 - 2,000.00
>=1 Set
Meo Textile Clothing Co.LTDCustomizable travel bottles silicone containers set refillable silicone travel bottlesUSD $ 0.63 - 0.63
>=50 piec
Meo household Co.LTDCustomizable refillable silicone travel bottles soft touch cosmetic bottleUSD $ 0.65 - 0.65
>=50 piec
Meo household Co.LTD
Auto Focus Laser Head Glass Cup Wine Bottle Wood Laser Engraving Machine With RotaryUSD $ 3,600.00 - 4,000.00
>=1 Set
Meo Textile Clothing Co.LTD
High technology beer glass bottle b filler plant for small beer filling machine /1000BPH Craft Beer Glass bottle Filling MachineUSD $ 19,000.00 - 21,000.00
>=1 Set
Meo Textile Clothing Co.LTDCustomizable travel bottles silicone containers set cosmetic soft tubeUSD $ 0.63 - 0.63
>=50 piec
Meo household Co.LTD
5ml portable mini perfume empty spray bottle easy to fill scent refillable atomizer pump case for party traveling outUSD $ 0.11 - 0.13
>=5000 Piece
Meo household Co.LTD
Pet Plastic Bottles 10ml 15ml 20ml 30ml 50ml 60ml 80ml 100ml 120ml 200ml 250ml Mini Fine Mist Alcohol Spray BottleUSD $ 0.20 - 0.32
>=1000 piec
Meo Food Co., Ltd.
High Quality Professional manicure tools acrylic nail art glue bottle with brush nail decoration glue for false nail tipsUSD $ 0.55 - 0.75
>=30 piec
Meo Food Co., Ltd.
Semi-automatic 5tin bottle of craft beer filling machine/5Tin kegUSD $ 2,000.00 - 13,450.00
>=1 Set
Meo Textile Clothing Co.LTD
Tongda beer filling machine stainless steel wine bottle filler gun with co2 pressureUSD $ 8,500.00 - 135,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Pet Portable Multifunctional Pet Outdoor Dog Travel Drinking Water Bottle With ButtonUSD $ 3.48 - 4.62
>=2 piec
Meo Food Co., Ltd.
DIY Glitter Craft 6 Colors Glitter Set Plastic Bottle Easy For KidsUSD $ 1.50 - 3.50
>=2000 Set
Meo Food Co., Ltd.
Clear Plastic Storage Organizer Container with Cutout Handles Transparent 4pcs Kitchen Cabinet Storage for Pantry RefrigeratorUSD $ 0.80 - 1.54
>=100 Piece
Meo Food Co., Ltd.
4060 50w 60w liaocheng best sale wood craft cutting and ruber fiber stamp carving machine for mdf plastic jewelry sheet pen ringUSD $ 1,212.00 - 1,818.00
>=1 Set
Meo Textile Clothing Co.LTD
6-6-1 Glass Bottle Craft Beer Filling Machine / Small Scale Brew Bottling PlantUSD $ 17,000.00 - 18,000.00
>=1 Set
Meo Textile Clothing Co.LTD
semi automatic manual round craft brew beer bottle jar cans stickers desktop labeling machine for plastic glass metalUSD $ 10,000.00 - 10,000.00
>=1 Acre(s)
Meo Textile Clothing Co.LTD
Children Portable Spill Proof Juice Soda Water Bottle Twist Cover Cap With StrawUSD $ 0.80 - 1.10
>=100 Piece
Meo household Co.LTD
5 In 1 Easy Opener - Replace 5 Bulky Kitchen Utensils Like Can Openers, Jars Openers And Bottle Openers With This Quality MultiUSD $ 0.25 - 0.50
>=100 Piece
Meo Food Co., Ltd.
Craft paint holder Spice Organizer Clips - Two polybag packages with header card containing a total of 30 clipsUSD $ 70.00 - 70.00
>=10 Unit
Meo Food Co., Ltd.
Lightweight And Simple Easy Grip Handle Plastic Pull Ring Can Ring Pull Bottle OpenerUSD $ 2.33 - 3.49
>=1000 Piece
Meo Food Co., Ltd.
Hot Selling 350ml Portable Dog Outdoor Water Bottle Pets Travel Water Bottle With RopeUSD $ 3.18 - 4.28
>=2 piec
Meo Food Co., Ltd.
250ml Blue White Amber Clear cylinder shape PET plastic trigger spray bottle mist spray oil spray bottleUSD $ 0.20 - 0.32
>=1000 piec
Meo Food Co., Ltd.
Plastic Spice Organizer Clips - Two polybag packages with header card contains 30 clipsUSD $ 70.00 - 70.00
>=10 Unit
Meo Food Co., Ltd.
Plastic Pantry Spice Organizer Clips - One polybag package with header card contains 15 clipsUSD $ 80.00 - 80.00
>=20 Unit
Meo Food Co., Ltd.
Best Plastic Pantry Spice Organizer Clips - One polybag package with header card contains 15 clipsUSD $ 80.00 - 80.00
>=20 Unit
Meo Food Co., Ltd.
Non Folding Plastic Spice Organizer Clips - One polybag package with header card contains 15 clipsUSD $ 80.00 - 80.00
>=20 Unit
Meo Food Co., Ltd.
Plastic detachable clips per strip Spice Organizer Clips - One polybag package with header card contains 15 clipsUSD $ 80.00 - 80.00
>=20 Unit
Meo Food Co., Ltd.
Most Popular Auto Products Beer Soft Drink Fully Automatic filler small glass bottle filling and capping machineUSD $ 19,000.00 - 21,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Manufacturers selling oral spray bottle frosted spray bottle 30ML,60ML,100ML,500ML beauty spray bottleUSD $ 0.20 - 0.32
>=1000 piec
Meo Food Co., Ltd.
latest design Spice Organizer Clips - Two polybag packages with header card contains 30 clipsUSD $ 80.00 - 80.00
>=20 Unit
Meo Food Co., Ltd.Related Searches:
rexlacecraftwithdisposablecupsplasticgimpcordplasticcanvasmagnetssmallplasticbottlecraftplasticcanvaskitsforbeginnersplasticformakingstencilsbucillaplasticcanvasplasticcrochetcraftstomakewithplasticbottlesplasticbottlecapmagnetsplasticcrossstitchplasticbottlecapartsimpleplasticbottlecraftsusanbatesplasticcrochethooksplasticlanyardcraftboyeplasticcrochethooksplasticbottlechristmascraftsplasticlacecraftsstencilsplasticplasticcanvaschristmaspvcpipekidprojectsplasticcanvasbytheyardwaterbottlecraftsforpreschoolplasticcanvasheartshapeplasticeggcartoncraftsplasticcanvasprojectsdiybirdfeederplasticbottlecraftplasticrecycledplasticweaving