Welcome to TradeChina
RELATED CATEGORIES:
Custom Printed PVC/PET Plastic Heat Wrap Shrink Sleeve Label for Bottle/Perforated pvc shrink sleeve bottle labelsUSD $ 0.03 - 0.03
>=500 Piece
Meo household Co.LTD
Wholesale Smell Proof Zip Lock Bags Black Matte Aluminum Mylar Foil Heat Sealable VAPE Weed Bag PackagingUSD $ 0.05 - 0.15
>=1000 piec
Meo household Co.LTD
Fancy Ziplock Plastic Gift Bags Wholesale Colorful No.979 Green Non Woven Die Cut BagUSD $ 0.01 - 0.02
>=100000 Piece
Meo household Co.LTD
Asuwant 100% Food Grade Packaging Aluminum Foil Custom Standup Zip Top Biodegradable Plastic Bag Reusable Snack BagsUSD $ 0.02 - 0.20
>=10000 Piece
Meo household Co.LTD
custom printed plastic handle bag for rice packing heat seal plastic bag 5kg 10kg 15kgUSD $ 0.03 - 0.04
>=20000 Piece
Meo household Co.LTD
hot sale laminated material cloth packing plastic zip lock bagUSD $ 0.01 - 0.90
>=10000 Piece
Meo household Co.LTD
Custom Logo Printing Biodegradable Zip lock plastic packaging bag Clear Square Window Reusable aluminum transparant plastic bagUSD $ 0.03 - 0.06
>=100 Piece
Meo household Co.LTD
Heat Seal Plastic Bag Three Side Sealed Zip Lock Bag For Usb Cables And Phone CaseUSD $ 0.02 - 0.02
>=10000 Piece
Meo household Co.LTD
Resealable ziplock cell phone case zip lock packaging bag phone caseUSD $ 0.03 - 0.50
>=100 piec
Meo household Co.LTD
Compostable White Stand Up Kraft Paper Zip Lock Bag Mylar Doypack Zipper Bag For Dried MangoesUSD $ 0.01 - 0.01
>=5000 Piece
Meo household Co.LTD
Custom Clear Reclosable Plastic Zip Lock Zipper Storage Poly Packaging BagsUSD $ 0.03 - 0.15
>=5000 piec
Meo household Co.LTD
pvc shrink sleeve label shrink mineral water label heat shrinkable bagsUSD $ 0.05 - 0.07
>=50000 piec
Meo household Co.LTD
Zip lock Storage Bags Aluminum Foil Mylar Matt Black White with Frosted Window for Dried Fruit Coffee Bean Candy PackagingUSD $ 0.03 - 0.03
>=10000 Piece
Meo household Co.LTD
900g Custom order bespoke size and design matt plastic printing zip lock stand up pouch for whey protein powder packaging+bagsUSD $ 0.02 - 0.10
>=1000 Piece
Meo household Co.LTD
ziplock t-shirt plastic packaging bag/plastic bag zip lock stand up/socks packaging bagUSD $ 0.01 - 0.90
>=10000 Piece
Meo household Co.LTDRelated Searches:
40mmheatshrinktubingshrinkcabletubeheatshrink3mshrinkablesleeveselectrical1inchshrinktubing1inchheatshrinksmallheatshrinktubingbestqualityheatshrinktubingpvcheatshrinksleevelargeshrinktubingcoloredshrinktubingsplitheatshrinktubingadhesiveshrinktubepinkheatshrinkraychemheatshrinkablesleevesheatshrinkwrapforelectricalwires35mmheatshrinkthermalshrinkwrappvcshrinktubeteflonshrinktubingptfeshrinktubing2mmheatshrinktubingheatshrinkwraptapenonheatshrinktubingneonheatshrinktubingraychemshrinktubing80mmheatshrinkwaterproofheatshrinktapelongheatshrinktubing3to1heatshrink