Welcome to TradeChina
crushing thoroughly suitable for all kinds of food residue kitchen food waste processorUSD $ 100.00 - 110.00
>=1 Set
Meo Advertising Co.LTD
eco friendly Wholesale natural Sustainable Zero Waste reusable wax food wrap fresh keeping wrapUSD $ 3.59 - 4.78
>=1 Set
Meo Auto Parts Co.LTD
Hot Sale Customized Color and Size Food Wrap Flexible Packaging Roll Film For Chips for Packaging FilmUSD $ 0.80 - 1.25
>=1 Ton
Meo household Co.LTD
Texupday Zero Waste Beeswax Food Storage Wrap Organic Cotton Cloth Reusable Wrap Bee Wax WrapUSD $ 2.50 - 4.40
>=100 piec
Meo Auto Parts Co.LTD
100% Biodegradable Organic Cotton Natural Eco Zero Waste Product Beeswax Wraps Food Wrap Bees Wax Food Paper SetUSD $ 3.70 - 4.00
>=5 Set
Meo Auto Parts Co.LTD
Zero Waste Kitchen 3pack 100% organic cotton reusable wrap beeswax food wrapsUSD $ 1.25 - 5.50
>=10 pieces
Meo Auto Parts Co.LTD
Washable Reusable Beeswax Food Wrap Paper Sheet Bee Wax Natural Organic Food WrapsUSD $ 0.80 - 1.20
>=100 piec
Meo Auto Parts Co.LTD
Reusable Wax Food Wraps Eco Friendly Sustainable Zero Waste cover for Food to Keep Fresh Beeswax WrapUSD $ 2.39 - 3.55
>=300 set
Meo Auto Parts Co.LTD
Beeswax food wrap Factory new product Promotion LFGB GOTS zero waste Eco friendly beeswax reusable beeswax wrapUSD $ 2.50 - 4.20
>=100 sets
Meo Auto Parts Co.LTD
Zero Waste Plastic Free Non Toxic Sustainble Organic Reusable Food Beeswax WrapUSD $ 2.99 - 3.50
>=50 Set
Meo Auto Parts Co.LTD
Zero Waste Reusable Beeswax Food Wrap, Eco Friendly, Organic Food Storage Wrappers Cling SandwichUSD $ 3.80 - 4.50
>=1 piec
Meo Auto Parts Co.LTD
Sopurrrdy Zero Waste Kitchen 3pack 100% organic cotton reusable wrap beeswax food wrapsUSD $ 2.45 - 4.45
>=100 Set
Meo Auto Parts Co.LTD
Zero waste plastic Free food storage cover Sustainable kitchen reusable wrapper roll custom printed bread bag Beeswax Food WrapUSD $ 2.68 - 3.88
>=10 Set
Meo Auto Parts Co.LTD
Organic Eco friendly zero waste sustainable Food storage wraps Soywax Vegan WrapsUSD $ 2.70 - 3.80
>=100 Set
Meo Auto Parts Co.LTD
yellow beeswax zero waste produce bags organic healthy safe bees wax food wrapUSD $ 1.50 - 3.90
>=100 Piece
Meo Auto Parts Co.LTD
Reusable Wax Food Wraps Eco Friendly Sustainable Zero Waste cover for Food to Keep Fresh Beeswax WrapUSD $ 2.50 - 3.50
>=100 Set
Meo Auto Parts Co.LTD
Alternative Plastic Wrap Save Money Amazon FDA LFGB Reusable Beeswax Food Wrap Zero Waste Protect TurtlesUSD $ 4.00 - 4.20
>=20 Bag(s)
Meo Auto Parts Co.LTD
Food Grade Zero Waste Kitchen 6 Pack Sets Beeswax Bread WrapUSD $ 3.80 - 5.00
>=10 sets
Meo Auto Parts Co.LTD
GOTS certified organic cotton high quality reusable zero waste beeswax food wrapUSD $ 7.90 - 8.30
>=100 sets
Meo Food Co., Ltd.
Zero Waste Eco Friendly Food Wrap Beeswax bags Reusable Natural Cotton Beeswax Food Storage bagsUSD $ 2.50 - 4.50
>=100 pieces
Meo Auto Parts Co.LTD
Top Goods 100% Organic Eco-Friendly Zero Waste Available Stocks Plain Beeswax Wrap SetUSD $ 3.09 - 4.67
>=50 Set
Meo Auto Parts Co.LTD
Bulk organic beeswax food additives / raw pure yellow bee wax wrap zero wasteUSD $ 5.90 - 8.90
>=1 Kilogram
Meo Auto Parts Co.LTD
Organic Beeswax Food Wraps 13*39 Inch Beeswax Sustainable Food Storage Reusable Zero Waste Food Wrap RollUSD $ 4.10 - 4.35
>=2 sets
Meo Auto Parts Co.LTD
Sandwich Beeswax Food Wraps Natural Storage Zero Waste Cheese and Washable Bowl CoverUSD $ 0.89 - 0.99
>=100 pieces
Meo Auto Parts Co.LTD
GOTS Water Proof organic cotton eco friendly bee wax food wrapUSD $ 2.50 - 3.80
>=100 Set
Meo Auto Parts Co.LTD
Eco Zero Waste Product Beeswax Wraps Food Wrap Bees Wax Paper Set Natural 100 Biodegradable Organic Cotton Bag OEM CustomizedUSD $ 4.77 - 6.20
>=30 rolls
Meo Auto Parts Co.LTD
Washable Reusable Food Storage Alternative Beeswax Food WrapsUSD $ 5.49 - 5.99
>=100 sets
Meo Auto Parts Co.LTD
3Pcs/set LFGB Food Grade Sandwich Washable Reusable Organic Cotton Leaf Beeswax Food Paper WrapsUSD $ 2.98 - 3.98
>=1 Set
Meo Auto Parts Co.LTD
Eco Friendly 100% Organic Cotton food grade kitchen Beeswax Food Wrap replacementUSD $ 3.60 - 4.80
>=100 Set
Meo Auto Parts Co.LTD
Sandwich Lunch bag Amazon hot Selling Biodegradable Natural Organic Cotton Fabric Beeswax reusable Food bagUSD $ 2.50 - 3.30
>=100 sets
Meo Food Co., Ltd.
100% Biodegradable Organic Cotton Natural Eco Zero Waste Product Beeswax Wraps Food Wrap Bees Wax Paper SetUSD $ 3.50 - 5.00
>=100 Bag(s)
Meo Auto Parts Co.LTD
Custom Eco-Friendly Sustainable Biodegradable Organic Cotton Reusable Beeswax Paper Beeswax Food WrapsUSD $ 3.59 - 5.12
>=100 sets
Meo Auto Parts Co.LTD
Sustainable Eco Friendly Reusable Beeswax food wrap Storage PaperUSD $ 2.32 - 2.99
>=10 Piece
Meo Auto Parts Co.LTD
LFGB Zero-Waste Reusable Beeswax Wrap Eco Friendly Snack Fruit Sandwich Food Wax WrapsUSD $ 3.40 - 4.80
>=2 sets
Meo Auto Parts Co.LTD
Amazon Best Selling Sustainable Biodegradable Reusable Natural Organic Cotton Fabric Beeswax Food Wraps for Sandwich Lunch PackUSD $ 3.90 - 4.90
>=100 pieces
Meo Auto Parts Co.LTD
Eco friendly beeswax reusable food wraps food storage sustainable organic sandwich bags beeswax wrapUSD $ 2.19 - 3.19
>=100 pieces
Meo Auto Parts Co.LTD
Sustainable Reusable Custom Eco Friendly Organic Bees Wax Wrap Roll Storage Beeswax Food WrapUSD $ 1.00 - 4.00
>=200 Piece
Meo household Co.LTD
Related Searches:
clingwraprollplasticwraptocoverfoodbeeswaxpelletsforfoodwrapssaranwrapreusablewaxforfoodwrapspvcclingfilmveganreusablefoodwrapdiycottonbeeswaxfoodwrapssaranwraplargerollwaxedcottonfoodwrapsplasticclingwrapblackstretchwrapnearmebeeswaxfoodstoragewrapcookingfilmwrapclingwrappriceplastikwrapperwaxplasticwrapfoodplasticfilmbeeswaxgladwrapwaxfoodwrapsfoodwrappedinplasticeteeorganicreusablefoodwrapsbeeswaxclingwrapdiygladwrapinovenplasticfilmfoodbeeswaxformakingfoodwrapspackagingclingwrapwaxpaperclingwrapfoodwrapcutterclingfilmcutter