Welcome to TradeChina
RELATED CATEGORIES:
Made in Italy Best Quality 22 Months 1/8 Parmigiano Reggiano PDO CheeseUSD $ 24.65 - 49.30
>=720 Kilogram
Meo Auto Parts Co.LTD
BRC/IFS Pasteurized Fresh Mascarpone cheese from Cow 10 Kg bag Wholesale Made In Italy.USD $ 5.17 - 5.23
>=1600 Kiloampere
Meo Auto Parts Co.LTD
Hard Cheese Cattle Cottage Cheese Himalayan Yak ChewUSD $ 27.00 - 43.00
>=1 Kilogram
Meo Auto Parts Co.LTD
Dog Chews from Himalaya of Nepal Dog Treat Dog Foods Natural Milky Chews Toys Hard Dried Cheese Yak CheeseUSD $ 20.00 - 25.00
>=10 Kilogram
Meo Food Co., Ltd.
Multiple sizes mini 40g or small 45g yak cheese beef dual flavor bone dog treatsUSD $ 0.57 - 0.85
>=100 Bag(s)
Meo Food Co., Ltd.
Wholesale Bulk Parmesan Mozzarella Processed Cheddar Yak Italian Hard CheeseUSD $ 31.43 - 49.30
>=100 Kilogram
Meo Auto Parts Co.LTD
Yeti Small Chew BULK 3lb Box Approx. 40 pcs Himalayan chew yak milk Nepal cheese with cheese chewUSD $ 47.52 - 47.52
>=100 pieces
Meo Food Co., Ltd.
Hard Cheese Cattle Cottage Cheese Himalayan Yak ChewUSD $ 280.00 - 400.00
>=26 Ton
Meo Auto Parts Co.LTD
Nepal natural organic milk yak cheese dog chew without additivesUSD $ 13.00 - 13.00
>=100 kilograms
Meo Auto Parts Co.LTD
100% Natural Himalayan Yaky Cheese Chew Long Lasting Stain Free Protein Rich Low Odor Healthy & Safe No LactoseUSD $ 3.52 - 3.52
>=36 Unit
Meo Food Co., Ltd.
Dogs Churpi Pet Chew Food Dog Chew Yak Milk Hard Cheese ChurpiUSD $ 15.00 - 18.65
>=500 Kilogram
Meo Food Co., Ltd.
Dogs Churpi Pet Chew Food Dog Chew Yak Milk Hard Cheese Churpi WholesaleUSD $ 20.00 - 20.00
>=500 kilograms
Meo Food Co., Ltd.
Yeti Large Chew BULK 3 lb Box Approx. 14 pcs Himalayan chew yak milk Nepal cheese with cheese chewUSD $ 47.52 - 47.52
>=100 pieces
Meo Food Co., Ltd.
Nepal natural soft yak adult dog treats chews food containsUSD $ 13.00 - 13.00
>=100 kilograms
Meo Auto Parts Co.LTD
Multiple sizes M 6 inch 115g yak cheese beef dual flavor bone dog treatUSD $ 1.50 - 1.74
>=50 Bag(s)
Meo Food Co., Ltd.
Yeti X large Chew BULK 3lb Box Approx. 8 pcs Himalayan chew yak milk Nepal cheese with cheese chewUSD $ 47.52 - 47.52
>=100 pieces
Meo Food Co., Ltd.
high quality Nepal natural yak puppy dog treats chews food wholesaleUSD $ 13.00 - 13.00
>=100 kilograms
Meo Auto Parts Co.LTD
No Lactose Himalayan Yaky Cheese Chew Long Lasting Stain Free Protein Rich Low Odor 100% Natural Healthy & Safe ChewmeterUSD $ 6.96 - 6.96
>=36 units
Meo Food Co., Ltd.
Multiple sizes L 8 inch 150g yak cheese beef dual flavor bone dog treatUSD $ 1.81 - 2.09
>=50 Bag(s)
Meo Food Co., Ltd.
bulk natural Nepal premium dry yak puppy dog treats chews foodUSD $ 13.00 - 13.00
>=100 kilograms
Meo Auto Parts Co.LTD
Long Lasting Himalayan Yaky Cheese Chew Stain Free Protein Rich Low Odor 100% Natural Healthy & Safe No Lactose ChewmeterUSD $ 3.52 - 3.52
>=36 units
Meo Food Co., Ltd.
Yeti Dog Nuggets (6-8 pieces), 3.5 ounce Himalayan chew yak milk Nepal cheese with cheese chewUSD $ 3.50 - 3.50
>=100 pieces
Meo Food Co., Ltd.
super premium natural soft dry yak puppy dog treats chews foodUSD $ 13.00 - 13.00
>=100 kilograms
Meo Auto Parts Co.LTD
Nepal premium natural soft dry yak puppy dog treats chews foodUSD $ 13.00 - 13.00
>=100 kilograms
Meo Auto Parts Co.LTD
premium natural Nepal soft dry yak pet dog treats chews foodUSD $ 13.00 - 13.00
>=100 kilograms
Meo Auto Parts Co.LTD
Healthy & Safe Himalayan Yaky Cheese Chew Long Lasting Stain Free Protein Rich Low Odor 100% Natural No LactoseUSD $ 4.53 - 4.53
>=36 units
Meo Food Co., Ltd.
Yeti Medium Chew BULK 3 lb Box Approx. 19 pcs Himalayan chew yak milk Nepal cheese with cheese chewUSD $ 47.52 - 47.52
>=100 pieces
Meo Food Co., Ltd.
soft yak adult puppy pet dog treats chews food contains wholesaleUSD $ 13.00 - 13.00
>=100 kilograms
Meo Auto Parts Co.LTD
Protein Rich Himalayan Yaky Cheese Chew Long Lasting Stain Free Low Odor 100% Natural Healthy & Safe No LactoseUSD $ 4.52 - 4.52
>=36 units
Meo Food Co., Ltd.
YETI BISCOTTI BULK BOX Himalayan chew yak milk Nepal cheese with cheese chewUSD $ 17.00 - 17.00
>=100 adet
Meo Food Co., Ltd.
Nepal organic high quality dry yak puppy dog treats chews foodUSD $ 13.00 - 13.00
>=100 kilograms
Meo Auto Parts Co.LTDRelated Searches:
donkeycheesephiladelphialightcreamcheesemexicandippingcheeseyellowcheesecheeseplatterslonghorncheeseburratapasteurizedshreddedpepperjackcheesedriedparmesancheesekraftdeluxecreamckraftparmesancheeserennetforcheesemakingsharpwhitecheddarliquidrennetnearmesharpcheddarhargacreamcheesevelveetamexicancheesekraftphiladelphiaparmesancheesepricebraziliancreamcheese5cheesemacaroniandcheesedonkeymilkcheesemakingricottacheesereducedfatcheddarcheesemakingnachocheeseorganicmozzarellacheeseparmigianocheeseyellowcheddarutzcheeseballs