Welcome to TradeChina
RELATED CATEGORIES:
Bracoo Mens Women Support Belt Neoprene Waist Trimmer Slimming Belt SE22USD $ 7.00 - 10.00
>=10 Bag(s)
Meo Electronic Technology Co.LTD
10 Pound Multi Weight Women Neoprene Dumbbells Hex Sets Lbs PoundsUSD $ 23.20 - 24.30
>=50 Pound
Meo Electronic Technology Co.LTD
Fitness slimming tummy belt body shaper waist trimmer waist trainer belt for womenUSD $ 2.25 - 2.55
>=200 Piece
Meo Electronic Technology Co.LTD
Custom Fitness neoprene Slimming Tummy Belt Sweet Sauna Weight Loss Waist Trimmer Sweat Belt for Women MenUSD $ 3.80 - 4.90
>=2 Piece
Meo Electronic Technology Co.LTD
Adjustable Weight Loss Belt Compression Waist Trimmer BeltUSD $ 1.70 - 2.00
>=5 piec
Meo Electronic Technology Co.LTD
Double Neoprene Sauna Waist Trainer Corset Sweat Belt for Women Weight Loss Compression Trimmer Workout FitnessUSD $ 7.20 - 8.50
>=500 piec
Homelife
Colorful custom waist trimmer belt support losing weight slimming trimmer running sports waist sweat beltUSD $ 3.65 - 4.50
>=100 Piece
Meo Electronic Technology Co.LTD
Premium Quality New Arrival Half Finger Custom With a Wrist Strap Women Sport Workout Fitness Weight Lifting Gloves Gym GlovesUSD $ 3.39 - 3.99
>=2 Pair
Meo Electronic Technology Co.LTD
Leather Custom Nantong Weight Lifting BeltUSD $ 9.05 - 14.29
>=2 Piece
Meo Electronic Technology Co.LTD
Custom Fitness Slimming Tummy Belt Sweet Sauna Weight Loss Waist Trimmer Sweat Belt for Women MenUSD $ 3.18 - 3.38
>=1 piec
Meo Electronic Technology Co.LTD
custom logo support breathable waist trainer body shaper sweat vest corset slimming belt for women weight lossUSD $ 2.96 - 11.70
>=2 Piece
Homelife
OEM customized logo sweat belt waist trimmer slimming belt women weight lossUSD $ 1.80 - 4.00
>=50 Piece
Meo Electronic Technology Co.LTD
Man woman fitness custom Logo neoprene trimmer slim waist sweat belt to lose weightUSD $ 1.95 - 2.25
>=100 Piece
Meo Electronic Technology Co.LTD
RTSYE-732 Shapewear Neoprene Sauna Waist Trainer Corset Sweat Belt for Women Weight Loss Trimmer Workout Fitness waist trainerUSD $ 2.22 - 2.42
>=10 Piece
Meo Electronic Technology Co.LTD
Wholesale Waist Support Custom Lever Weight Lifting Training Belt Gym Fitness Belt Ladies Pink Leather Weightlifting BeltUSD $ 10.50 - 13.50
>=2 Piece
Meo Electronic Technology Co.LTD
Black Sequence Women Gym Training Belt, Ladies Back Support Neoprene Weight Lifting Belt, Squats BeltUSD $ 4.50 - 5.50
>=100 Pair
Meo Electronic Technology Co.LTD
Customize Low Cost Belt waist trainer for women weight loss everyday wearUSD $ 8.73 - 9.51
>=3 piec
Meo Electronic Technology Co.LTD
Womens sweat belt and waist trainer waist training belt weight loss unisexUSD $ 2.60 - 3.10
>=1 piec
Meo Electronic Technology Co.LTD
neoprene nylon weight lifting gym back support training belt for men and womenUSD $ 2.25 - 3.95
>=20 Piece
Meo Electronic Technology Co.LTD
High Quality Heavy Duty Gym Fitness Workout Power Weight Lifting PU Leather Belt for Men WomenUSD $ 4.10 - 5.40
>=2 Piece
Meo Electronic Technology Co.LTD
High Quality Adjustable Weight Loss Waist Trainers Belt Slimming For WomenUSD $ 2.77 - 3.86
>=3 Piece
Meo Electronic Technology Co.LTD
Adjustable Customized Elastic Waist Slimmer Weight Loss Neoprene Waist Trainer Belt For WomenUSD $ 2.55 - 3.99
>=100 piec
Meo Electronic Technology Co.LTD
Trimmer Belt Adjustable Weight Loss Wrap Sweat Workout Neoprene Back Belt Custom Women Slimming Waist Support Waist TrainerUSD $ 2.89 - 3.49
>=10 piec
Homelife
High Quality Gym Fitness Heavy Duty Leather Weight Lifting Belt for Men Women PowerliftingUSD $ 2.95 - 4.59
>=10 piec
Homelife
Womens Neoprene Sweat Slimming Sports Waist Trimmer Belt For Loss WeightUSD $ 2.75 - 3.08
>=1 piec
Meo Electronic Technology Co.LTD
Custom Womens Gym Health Waist Losing Neoprene Weight Lifting BeltsUSD $ 12.00 - 24.00
>=1 Piece
Meo Electronic Technology Co.LTD
Custom women neoprene dipping weight lifting beltUSD $ 2.00 - 5.00
>=10 Piece
Meo Electronic Technology Co.LTD
Size Unisex Sweat Back Suit Sport For Weight Loss Wholesale Slimming Sauna Support Trimmer Women Waist Trainer BeltUSD $ 1.84 - 2.60
>=3 Piece
Meo Electronic Technology Co.LTD
Custom Fitness Slimming Tummy Belt Sweet Sauna Weight Loss Waist Trimmer Sweat Belt for Women MenUSD $ 3.35 - 3.72
>=10 Piece
Meo Electronic Technology Co.LTD
Women Push Up sweat Slim Neoprene waist trimmer belt for weight lossUSD $ 2.41 - 2.71
>=3 Piece
Meo Electronic Technology Co.LTD
Breathable Lower Back Support Gym Lumbar Waist Support Man Adjustable Athletic Belt For Losing Weight Women Waist Trimmer BeltUSD $ 5.99 - 5.99
>=1 Piece
Meo Electronic Technology Co.LTD
Men and Woman Sauna Sweat Slimmer Belt Neoprene waist belts weight loss trainer light weight waist trainer male and femaleUSD $ 1.84 - 3.44
>=3 piec
Meo Electronic Technology Co.LTD
Custom Logo Womens Power Training Weightlifting Gym Belt Weight LiftingUSD $ 3.39 - 4.32
>=50 Pair
Meo Electronic Technology Co.LTD
Belt Waist Trimmer Slimming Tummy Band Weight Loss Fitness Waist Trainer Belt for WomenUSD $ 7.00 - 12.00
>=10 piec
Meo Electronic Technology Co.LTD
New Type Waist Trimmer Belt Weight Loss Sweat Sauna Slim Belt for Men and WomenUSD $ 3.49 - 3.69
>=2 Piece
Meo Electronic Technology Co.LTD
Top Quality Durable Power Lifting Leather Lever Belt for Women in Purple ColorUSD $ 7.00 - 12.00
>=50 Piece
Meo Electronic Technology Co.LTD
Wholesale Custom Women Body Shaper Neoprene Sweat Slimming Sauna Exercise Waist Trainer BeltUSD $ 5.86 - 6.92
>=1 piec
Homelife
Power Lifting Belts Fitness Genuine Leather Pro Weight Lifting Belt for Men and WomenUSD $ 12.50 - 14.50
>=50 piec
Meo Electronic Technology Co.LTD
Women Waist Trainer Vest Slim Corset Neoprene Sauna Tank Top Zipper Weight Loss Body Shaper ShirtUSD $ 4.34 - 6.50
>=2 piec
Meo Electronic Technology Co.LTD
Customized Logo 100% Genuine Leather Gym Power Lifting Cross Fit Fitness Weight Lifting Belt Waist protection Buckle Men WomenUSD $ 14.13 - 21.74
>=2 piec
Meo Electronic Technology Co.LTD
Custom Womens Neoprene Slimming Sauna Waist Trimmer Belt For Loss WeightUSD $ 13.00 - 14.00
>=500 Piece
Meo Electronic Technology Co.LTD
Enerup Private label Neoprene Sweat Waist Support Trainer Corset Trimmer Belt for Women Weight Loss Waist Cincher Shaper SlimmerUSD $ 2.96 - 2.96
>=3 Piece
Meo Electronic Technology Co.LTD
Amazon Hot Sale Gym workout Body Shaperi Slimming Women Waist Trimmer Private Label Waist Trainer Logo Hot Belt To Lose WeightUSD $ 2.23 - 3.86
>=2 Piece
Meo Electronic Technology Co.LTD
Customized Rubber Logo Workout Gym Fitness Waist Belt Cow Leather Power lifting weight lifting Dip Belt Dipping belt Men WomenUSD $ 20.72 - 31.88
>=2 piec
Meo Electronic Technology Co.LTD
Womens Neoprene Sweat Slimming Sauna Waist Trimmer Belt For Loss WeightUSD $ 2.79 - 3.59
>=10 Piece
Meo Electronic Technology Co.LTD
Custom Logo Neoprene Fitness Waist Support Trimmer Belt Slimming Sweat Belt For Women Running Lose WeightUSD $ 2.30 - 4.30
>=50 Piece
Meo Electronic Technology Co.LTD
2019 Amazon Best Seller Exercise Waist Sweat Band Weight Loss Sweat Belt Slimming Waist Trimmer For Women MenUSD $ 3.15 - 3.82
>=1 piec
Meo Electronic Technology Co.LTD
Professional gym dip belt with chain weight lifting training fitness weightlifting leather dipping beltUSD $ 2.50 - 8.00
>=10 Pair
Meo Electronic Technology Co.LTD
Related Searches:
weightliftingbodyrogueweightliftingbeltliftingbeltsnearmegymweightliftingglovesheavyweightliftingforfemalesweighttrainingforwomenathomeweighttrainingglovesmensjustliftbeltweightliftingglovesforwomenliftingbenchrdxstrapsweightliftingforwomen'sfatlosscustomliftingbeltsbestweightliftingbeltforsquatsanddeadliftsgold'sgymweightliftingglovesweighttrainingprogramforwomenbodyweighttrainingforweightlossweightliftingplateswriststrapsliftingfatburningweightliftinggymtrainingglovesliftinghooksgymfingerlessweightliftingglovesweightliftingsystemweightliftinggloveswithhooksbestolympicweightliftingbeltweightliftingglovesformengymbeltonlinebestdeadliftstrapsmetalpowerliftingbelt