Welcome to TradeChina
RELATED CATEGORIES:
- Beauty & Personal Care
- Construction & Real Estate
- Consumer Electronics
- Electrical Equipment & Supplies
- Environment
- Food & Beverage
- Furniture
- Gifts & Crafts
- Home & Garden
- Home Appliances
- Machinery
- Mechanical Parts & Fabrication Services
- Packaging & Printing
- Rubber & Plastics
- Security & Protection
- Service Equipment
- Sports & Entertainment
- Toys & Hobbies
- Vehicles Parts & Accessories
Eletronic locking system 80mm thermal receipt panel printer for vending machineUSD $ 130.00 - 138.00
>=10 piec
Meo Textile Clothing Co.LTD
Raspberry Pi Wiegand QR Bar Code Reader Module Vending Machine Barcode Scanner ModuleUSD $ 62.00 - 75.00
>=2 piec
Meo Textile Clothing Co.LTD
Wholesale Hot Sale Custom Multifunctional Medical Mask Vending MachineUSD $ 150.00 - 300.00
>=1 piec
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinderUSD $ 7.70 - 7.70
>=1000 Piece
Meo Textile Clothing Co.LTD
Auto Beauty Vending Machine for Hair and Lashes Best seller hair lashes vending machine with free customized wrapUSD $ 888.00 - 1,480.00
>=1 Set
Meo Textile Clothing Co.LTD
6 bottle wine dispenser fridge mini vending machine for saleUSD $ 2,600.00 - 3,000.00
>=1 piec
Meo Textile Clothing Co.LTD
water vending machines for sale purified water,self-service water vending stationUSD $ 1,500.00 - 1,900.00
>=1 Set
Meo Textile Clothing Co.LTD
Self-service mini vending machine for face masksUSD $ 150.00 - 200.00
>=1 piec
Meo Textile Clothing Co.LTD
coin operated RO reverse osmosis vending machines for sale purified waterUSD $ 849.00 - 899.00
>=2 Unit
Meo Textile Clothing Co.LTD
italy vending machine for sale milk and waterUSD $ 1,300.00 - 1,500.00
>=1 Set
Meo Textile Clothing Co.LTD
best price snack foods and drinks water french fries combo cup noodle vending machines for saleUSD $ 620.00 - 775.00
>=1 piec
Meo Textile Clothing Co.LTD
reverse vending machines coin operated alkaline purified water vending machine for sale purified waterUSD $ 1,455.00 - 1,999.00
>=2 Unit
Meo Textile Clothing Co.LTD
custom locker vending machine for sale water or vegetableUSD $ 575.00 - 775.00
>=1 Set
Meo Textile Clothing Co.LTD
Christmas Commercial Hot Selling Coin and Bill Acceptor 200GPD Purified Water Vending Machine for Sale Water Bottle Vending Machine Kenya PromotionUSD $ 1,500.00 - 1,650.00
>=1 Piece
Meo Textile Clothing Co.LTD
IOTHUB 24 hours online self service convenience automatic water coffee black combo drink vending machine for saleUSD $ 1,499.00 - 2,500.00
>=1 Piece
Meo Textile Clothing Co.LTD
OEM Purified Water Vending Machines Vending Station Self-service Water Dispenser for Sale Purified WaterUSD $ 1,443.00 - 1,778.00
>=1 Piece
Meo Textile Clothing Co.LTD
smart touch screen mini small mask coffee snack water vending machine automatic for saleUSD $ 200.00 - 200.00
>=500 Set
Meo Textile Clothing Co.LTD
water refilling station alkaline purified coin reverse osmosis ro drinking water vending machines for sale purified waterUSD $ 560.00 - 780.00
>=1 Piece
Meo Textile Clothing Co.LTD
Hot sale OEM Reverse Osmosis commercial alkaline water refilling station RO water vending machineUSD $ 1,155.00 - 1,365.00
>=3 Set
Meo Textile Clothing Co.LTD
Hot Sale Self Sale Purified Water Purification Vending MachinesUSD $ 1,500.00 - 2,500.00
>=1 Piece
Meo Textile Clothing Co.LTD
Coin Commercial Ice & Water Drinking Vending MachineUSD $ 5,000.00 - 8,000.00
>=1 Piece
Meo Textile Clothing Co.LTD
Factory price self water drink outdoor contactless vending machine made in china for saleUSD $ 1,799.00 - 2,599.00
>=1 Set
Meo Textile Clothing Co.LTD
RO Purified Water Vending Machine/ drinkable water vendorUSD $ 1,000.00 - 2,000.00
>=1 Set
Meo Textile Clothing Co.LTD
800 GPD Pure water Service Station for 24 hours /Aqua water vending machine for sale with CE CertificateUSD $ 1,000.00 - 2,000.00
>=1 Unit
Meo Textile Clothing Co.LTD
Commercial Coin Operated Water Vending Machine for for Drinking WaterUSD $ 1,400.00 - 1,500.00
>=100 piec
Meo Textile Clothing Co.LTD
custom cup noodle vending machine water vending machines for saleUSD $ 549.99 - 549.99
>=1 Set
Meo Textile Clothing Co.LTD
mini water coffee book top up jewelry vending machine for saleUSD $ 1,188.00 - 2,199.00
>=1 Set
Meo Textile Clothing Co.LTD
Customer Design Water Vending Machines For SaleUSD $ 780.00 - 980.00
>=1 Set
Meo Textile Clothing Co.LTD
Europe Hot Sale Smart Vending Machine for Bread Cake Water BeverageUSD $ 1,000.00 - 3,500.00
>=1 Set
Meo Textile Clothing Co.LTD
LK501 Time type electronic control board with LK400M coin acceptor for commercial bottled water vending machineUSD $ 1.00 - 60.00
>=1 Piece
Meo Textile Clothing Co.LTD
Small wall mounted vending machine for saleUSD $ 250.00 - 1,250.00
>=1 Piece
Meo Textile Clothing Co.LTD
self-service automatic drinking pure water vending machineUSD $ 699.00 - 1,699.00
>=1 Set
Meo Textile Clothing Co.LTD
YN Gym Cold Drink Protein Shake Cheap Vending Machine for SaleUSD $ 1,799.00 - 1,799.00
>=1 Set
Meo Textile Clothing Co.LTD
Special refrigerator water vending machine for super hot weatherUSD $ 1,300.00 - 1,900.00
>=1 Set
Meo Textile Clothing Co.LTD
Reverse Vending Machine for recycling plastic water bottles and aluminum cansUSD $ 4,500.00 - 4,800.00
>=1 Unit
Meo Textile Clothing Co.LTD
Toy vending machine plastic capsules/cupcake vending machine/instant noodle vending machine priceUSD $ 2,000.00 - 3,000.00
>=1 Set
Meo Textile Clothing Co.LTD
SNBC BVM-RI211 Modern Design Water Vending Machine Snack For CBD Let S Pizza Vending MachineUSD $ 4,200.00 - 8,000.00
>=10 Set
Meo Textile Clothing Co.LTD
TCN Automatic icecream ice and water vending machines for saleUSD $ 3,669.00 - 4,269.00
>=1 Set
Meo Textile Clothing Co.LTD
Zoomgu Small snack drink water vending machines for saleUSD $ 1,269.00 - 2,239.00
>=1 piec
Meo Textile Clothing Co.LTD
coin operated water vending machine purified water for saleUSD $ 1,635.00 - 1,835.00
>=1 Set
Meo Textile Clothing Co.LTD
China good price ce certs water ice vending machine detergent vending machine tcn vending machine for saleUSD $ 520.00 - 545.00
>=1 Piece
Meo Textile Clothing Co.LTD
ZG 2020 hot sale small drink combo water vending machine snackUSD $ 1,269.00 - 2,239.00
>=1 Set
Meo Textile Clothing Co.LTD
Hot / Iced Instant Freshly Bean to Cup Coffee Vending Machine for saleUSD $ 4,000.00 - 4,800.00
>=1 Piece
Meo Textile Clothing Co.LTD
Hot sale self-service automatic drinking pure water vending machine Business water dispenserUSD $ 1,104.00 - 1,104.00
>=10 Piece
Meo Textile Clothing Co.LTD
OEM ODM Service 316L Stainless Steel Water Tank for Coffee Maker Water Boiler for Coffee Vending Machines Coffee Machine TankUSD $ 46.00 - 48.00
>=50 piec
Meo Textile Clothing Co.LTD
water valve one in three out for coffee vending machineUSD $ 6.00 - 10.00
>=1 piec
Meo Textile Clothing Co.LTD
water food drink beer automatic self vending machine machines for saleUSD $ 1,579.00 - 1,579.00
>=5 Set
Meo Textile Clothing Co.LTD
mini water coffee book top up jewelry vending machine for saleUSD $ 1,199.00 - 1,829.00
>=1 Set
Meo Textile Clothing Co.LTDRelated Searches:
vendingsupplyoldpepsivendingmachinemilkvendingmachinepricecontactlessvendingmachineforsalesnacksvendingmachinepricevendingmachinebusinessforsalenearmecakevendingmachinedrinkvendingmachinenearmenayaxcardreadersolarpoweredvendingmachinebeervendingmachineforsalegiftcardvendingmachineantaresvendingmachinebestsellingvendingmachinecandyvendingmachineshopvendingsystemvintagesodamachinesforsaleteaandcoffeemachineforofficecoffeevendomachineforsalecoldfoodvendingmachinesmechanicalvendingmachinecappuccinovendingmachinesweetdispensermachinefooddispensermachineicecreamvendingmachineforsalecoffeepremixforvendingmachinevendingmachinesforsaleebayretrocokemachineantiquecocacolamachinevendingmachineplacement