Welcome to TradeChina
Raspberry Pi Wiegand QR Bar Code Reader Module Vending Machine Barcode Scanner ModuleUSD $ 62.00 - 75.00
>=2 piec
Meo Textile Clothing Co.LTD
Ticket Vending machine Self Service Ticketing Kiosk for CinemaUSD $ 990.00 - 1,079.00
>=1 Piece
Meo Textile Clothing Co.LTD
Factory OEM hotel key card dispenser kiosk 15.6-21.5 inch touch screen ticket vending machineUSD $ 1,000.00 - 1,300.00
>=1 piec
Meo Textile Clothing Co.LTD
A Vending Machine For The Sale of CondomsUSD $ 499.00 - 1,100.00
>=1 Piece
Meo Textile Clothing Co.LTD
Customize CNC Machining Popcorn Coin Part Coffee Vending Machine Spare PartsUSD $ 90.00 - 90.00
>=10 piec
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinderUSD $ 7.70 - 7.70
>=1000 Piece
Meo Textile Clothing Co.LTD
smart 24 hours self-service automatic milk food snack drink vending machine for milk food snack and drinksUSD $ 1,345.00 - 1,345.00
>=27 Set
Meo Textile Clothing Co.LTD
Floor stand 21.5inch ticket vending payment machine digital self ordering touch pos kioskUSD $ 498.00 - 598.00
>=1 Unit
Meo Textile Clothing Co.LTD
TCN Hot food vending machine usa supplier price microwave box meal vending machine Premade meals vending machineUSD $ 3,510.00 - 4,500.00
>=3 Set
Meo Textile Clothing Co.LTD
Zoomgu China Supplier Best Choice Customized Coffee Vending MachineUSD $ 3,560.00 - 3,860.00
>=1 Unit
Meo Textile Clothing Co.LTD
AF-S770 AFEN china gold supplier convenient storage medicine pharmacy products vending machines for saleUSD $ 899.00 - 1,000.00
>=1 Set
Meo Textile Clothing Co.LTD
2019 Supplier Selling Mini ice cream vending machine cosmetics protein shake vending machine automaticUSD $ 2,600.00 - 3,315.00
>=1 Set
Meo Textile Clothing Co.LTD
Hot sale and low price vending machines +suppliers ZJ504TUSD $ 30.00 - 30.00
>=1 Piece
Meo Textile Clothing Co.LTD
Chinese Supplier Multi Layer Gashapon Capsule Toy Vending MachineUSD $ 100.00 - 300.00
>=1 Set
Meo Textile Clothing Co.LTD
2020 Best Price Automatic Snack And Drink Vending MachineUSD $ 1,500.00 - 1,650.00
>=1 Set
Meo Textile Clothing Co.LTD
zhonggu made in china high quality elevator lift type maquina expendedora vending machineUSD $ 1,200.00 - 1,600.00
>=1 Set
Meo Textile Clothing Co.LTD
China Supplier Cheap Latest Touch Screen Water Vending MachineUSD $ 820.00 - 1,200.00
>=1 Set
Meo Textile Clothing Co.LTD
Professional manufacturer supplier cigarette vending machine with touch screenUSD $ 1,500.00 - 2,655.00
>=1 Set
Meo Textile Clothing Co.LTD
HUIZU WM22-W 24 hours self-service touch screen snack drink vending machine for Guangzhou vending machine supplierUSD $ 1,680.00 - 1,910.00
>=1 Set
Meo Textile Clothing Co.LTD
China vending machine supplier with high quality and lifetime free maintenance serviceUSD $ 2,000.00 - 2,200.00
>=1 Set
Meo Textile Clothing Co.LTD
Self-Service Automatic Instant Coffee and Tea Vending Machine SupplierUSD $ 140.00 - 520.00
>=1 Set
Meo Textile Clothing Co.LTD
China manufacturer Flower vending machine with auto doorUSD $ 4,000.00 - 5,200.00
>=3 Piece
Meo Textile Clothing Co.LTD
China Supplier Reverse Osmosis Drinking Coin Operated Water Vending Machine For SaleUSD $ 1,500.00 - 2,500.00
>=1 Piece
Meo Textile Clothing Co.LTD
Chinese Supplier Industrial distributor Automatico Di Yogurt Vending MachineUSD $ 3,800.00 - 4,000.00
>=1 Unit
Meo Textile Clothing Co.LTD
Large capacity automatic combo self-service smart drink beverage snack Smart vending machine Micron WM22T1USD $ 2,990.00 - 3,491.00
>=1 Set
Meo Textile Clothing Co.LTD
Vendlife China Supplier Powerbank Mobile Accessories Vending Machine AutomaticUSD $ 3,200.00 - 3,380.00
>=1 Set
Meo Textile Clothing Co.LTD
Medical Face Masks Coin Vending Machines Disposable Facial Mask Vending Machine WD1-205SUSD $ 500.00 - 550.00
>=20 piec
Meo Textile Clothing Co.LTD
design kids toys vending machine toy vending machine suppliers coin counter token selling machineUSD $ 1.00 - 195.00
>=1 Piece
Meo Textile Clothing Co.LTD
Table Top Smart Bean To Cup Automatic Coffee Vending Machine with Advertising ScreenUSD $ 1,420.00 - 2,080.00
>=1 Set
Meo Textile Clothing Co.LTD
Factory gold supplier wholesale freshly squeezed orange juice vending machineUSD $ 5,000.00 - 6,000.00
>=1 Piece
Meo Textile Clothing Co.LTD
self-service automatic drinking pure water vending machineUSD $ 699.00 - 1,699.00
>=1 Set
Meo Textile Clothing Co.LTD
Office building Shopping mall combo small vending machineUSD $ 1,499.00 - 2,199.00
>=1 Piece
Meo Textile Clothing Co.LTD
let's pizza vending machine china suppliers / ice cream self vending machineUSD $ 3,000.00 - 4,500.00
>=1 Set
Meo Textile Clothing Co.LTD
Coin Operated Capsule Toy Bouncy Ball Vending Machine Whole saleUSD $ 200.00 - 240.00
>=20 Piece
Meo Textile Clothing Co.LTD
China Supplier Credit Card Fruit Juice Vending MachineUSD $ 6,600.00 - 8,800.00
>=1 Unit
Meo Textile Clothing Co.LTD
China Supplier Coin Operated Ce Certificated Alkaline Water Vending MachineUSD $ 1,540.00 - 2,000.00
>=1 Unit
Meo Textile Clothing Co.LTD
hot and cold espreso coffee vending machine coffee beans vending machine automatic with kiosk vendingUSD $ 3,400.00 - 3,400.00
>=1 Unit
Meo Textile Clothing Co.LTD
TCN intelligent snacks vending machine supplierUSD $ 2,499.00 - 2,599.00
>=2 Set
Meo Textile Clothing Co.LTD
Smart Wall Mount CBD Vending Machine with 32 Inch Touch Screen for PPE ProductsUSD $ 2,000.00 - 3,000.00
>=1 piec
Meo Textile Clothing Co.LTD
Renowned Canadian Supplier of 26 LBS Weight Alcohol Breathalyzer Vending MachineUSD $ 995.00 - 995.00
>=1 Unit
Meo Textile Clothing Co.LTD
China Bulk Vending Machines Touch Screen Orange Juice Vending Machine SupplierUSD $ 5,400.00 - 5,800.00
>=1 Unit
Meo Textile Clothing Co.LTD
China supplier lipstick lashes custom makeup vending machineUSD $ 1,514.00 - 1,978.00
>=1 Piece
Meo Textile Clothing Co.LTD
Wholesale Self-service Auto Face Mask Vending Machine Dispenser Surgical Mask Vending Machine for Mask otomatUSD $ 50.00 - 450.00
>=1 Piece
Meo Textile Clothing Co.LTD
drink vending machine supplier energy drink vending machinesUSD $ 1,569.00 - 2,169.00
>=2 Set
Meo Textile Clothing Co.LTD
Assessed Supplier Triwin Aqua Chief RO Water Vending MachineUSD $ 8,000.00 - 8,000.00
>=1 Unit
Meo Textile Clothing Co.LTD
Supplier Giant Capsule Bubble Egg Vending MachinesUSD $ 3,500.00 - 3,500.00
>=10 Unit
Meo Textile Clothing Co.LTD
Professional Supplier Vending Machine Large and Smart Cigarette Vender Food Snack and Drink VendorUSD $ 450.00 - 2,050.00
>=1 Piece
Meo Textile Clothing Co.LTD
Automatic Snack And Drink Combo Vending Machine SupplierUSD $ 4,000.00 - 5,000.00
>=10 Unit
Meo Textile Clothing Co.LTDRelated Searches:
cakevendingmachineantiquecocacolamachinecoldfoodvendingmachinescandyvendingmachinebusinesskoolericemachineforsalevendingsupplycontactlessvendingmachineforsalecolavendingmachinenestlecoffeevendingmachineoldpepsivendingmachineusedcombovendingmachinesusedcokemachinesnacksvendingmachinepricevendingsystemgiftcardvendingmachinesodavendingmachinebusinesslaysvendingmachinefrozenfoodvendingmachinessolarpoweredvendingmachinewatervendingquartercandymachinelocalvendingmachinecompaniessodacanmachinevendomachineforsalefrozenvendingmachinevendingstorebubblegumvendingmachineantaresvendingmachinetoycapsulemachinelavazzavending