Welcome to TradeChina
RELATED CATEGORIES:
Kubota main pump KX63,K035,KX175,KX165 excavator hydraulic pump KX121-2,KX92-1,KX161,KX42,KX43,KX45,KX65,KX61,KX91-2,KX172,KX85USD $ 1,500.00 - 2,500.00
>=1 Piece
Meo Textile Clothing Co.LTD
Eletronic locking system 80mm thermal receipt panel printer for vending machineUSD $ 130.00 - 138.00
>=10 piec
Meo Textile Clothing Co.LTD
Raspberry Pi Wiegand QR Bar Code Reader Module Vending Machine Barcode Scanner ModuleUSD $ 62.00 - 75.00
>=2 piec
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinderUSD $ 7.70 - 7.70
>=1000 Piece
Meo Textile Clothing Co.LTD
smart 24 hours self-service automatic milk food snack drink vending machine for milk food snack and drinksUSD $ 1,345.00 - 1,345.00
>=27 Set
Meo Textile Clothing Co.LTD
Wholesale Hot Sale Custom Multifunctional Medical Mask Vending MachineUSD $ 150.00 - 300.00
>=1 piec
Meo Textile Clothing Co.LTD
6 bottle wine dispenser fridge mini vending machine for saleUSD $ 2,600.00 - 3,000.00
>=1 piec
Meo Textile Clothing Co.LTD
Integrated Automatic Payment Vending Machine Shell Self-service Check-in Sheet Metal BoxUSD $ 318.00 - 341.00
>=1 Piece
Meo Textile Clothing Co.LTD
HOT Sale Commercial Coffee Vending Machine with 3 Flavor DrinksUSD $ 229.00 - 400.00
>=2 Set
Meo Textile Clothing Co.LTD
intelligent android vending machine for beverage with advertising functionUSD $ 2,269.00 - 2,869.00
>=2 Unit
Meo Textile Clothing Co.LTD
TCN automatic fast food breakfast lunch box vending machine for saleUSD $ 3,509.00 - 3,509.00
>=3 Set
Meo Textile Clothing Co.LTD
GV25 New business ideas kids toys vending machines for saleUSD $ 55.00 - 55.00
>=15 Piece
Meo Textile Clothing Co.LTD
400G RO coconut Water Filter water vending machine business for saleUSD $ 1,155.00 - 1,365.00
>=3 piec
Meo Textile Clothing Co.LTD
Mini Simple Small Size Cheap Snacks Fresh Milk Can Coin Operated Purified Water Coffee Vending Machine Business For SaleUSD $ 20.00 - 70.00
>=500 Set
Meo Textile Clothing Co.LTD
new business ideas coin operated water vending machine lift for saleUSD $ 2,600.00 - 2,800.00
>=1 Set
Meo Textile Clothing Co.LTD
AFEN business card automatic condom vending machine for saleUSD $ 1,199.00 - 1,859.00
>=1 Set
Meo Textile Clothing Co.LTD
TCN Small counter top vending machines for sale businessUSD $ 1,567.00 - 2,550.00
>=1 Set
Meo Textile Clothing Co.LTD
2019 hot business automatic drink vending machine/bulk vending machines for saleUSD $ 2,500.00 - 3,500.00
>=1 Set
Meo Textile Clothing Co.LTD
Best Quality Small Items Vending Machine Business For SaleUSD $ 350.00 - 400.00
>=1 Piece
Meo Textile Clothing Co.LTD
24 Hours Outdoor Business Self-service Food Vending Machine Pizza Vending Machines For SaleUSD $ 6,800.00 - 7,382.00
>=1 Set
Meo Textile Clothing Co.LTD
business wall mounted cigarette vending machine for saleUSD $ 549.99 - 549.99
>=1 Set
Meo Textile Clothing Co.LTD
vendor machine business for sale toy vending machine plastic capsules with 24 hour service toy mini vending machine for saleUSD $ 139.00 - 145.00
>=1 Piece
Meo Textile Clothing Co.LTD
Attractive design customized cartoon characts vending machines profitable businessUSD $ 1,850.00 - 1,960.00
>=10 Set
Meo Textile Clothing Co.LTD
Large Globe Gumball Bubble Vending Machine with Removable cash box single StandUSD $ 42.50 - 44.00
>=10 Set
Meo Textile Clothing Co.LTD
Large Globe with Removable cash box single Stand Outdoor Toy Gumball Vending Machine For saleUSD $ 39.00 - 69.00
>=1 Piece
Meo Textile Clothing Co.LTD
new business ideas vending machine self cheap automatic vending machine/popcorn vending machine/vending machines for saleUSD $ 2,000.00 - 2,500.00
>=1 Piece
Meo Textile Clothing Co.LTD
Business Startup Idea New Products to Sell for Small BusinessUSD $ 372.00 - 389.00
>=1 Unit
Meo Textile Clothing Co.LTD
2019 New Business 22inch Touch Screen Protein Drinks Vending Machine in ThailandUSD $ 1,500.00 - 2,600.00
>=5 Piece
Meo Textile Clothing Co.LTD
Hot Coffee Tea Chocolate Table Top Fully Automatic Coffee Vending MachineUSD $ 230.00 - 400.00
>=2 Set
Meo Textile Clothing Co.LTD
High Quality Products Claw Vending Machine Indoors Prize MachinesUSD $ 630.00 - 650.00
>=1 Unit
Meo Textile Clothing Co.LTD
Combo Cold Snack cheap vending machine Auto Vending Machine WD1-205AUSD $ 1,600.00 - 2,000.00
>=1 Piece
Meo Textile Clothing Co.LTD
2017 China wholesale factory instasnap Portable Photo kiosk / photobooth / photo booth shell for sale for business/vending/partyUSD $ 1,100.00 - 2,700.00
>=1 Piece
Meo Textile Clothing Co.LTD
Alibabaselect custom black vending machine / venting machine for vape snack food and drink beverage business in philippinesUSD $ 800.00 - 1,100.00
>=1 Set
Meo Textile Clothing Co.LTD
Big Capacity High-end Business 24 hours Automatic Wine Vending Machine PriceUSD $ 1,950.00 - 2,100.00
>=1 Set
Meo Textile Clothing Co.LTD
New 2021 Automatic double chamber triangle inner outer tea bag pouch packing machine for small businessUSD $ 5,000.00 - 5,100.00
>=1 Unit
Meo Textile Clothing Co.LTD
Orange juice vending machine with squeezing juice system and cleaning systemUSD $ 5,000.00 - 5,500.00
>=10 piec
Meo Textile Clothing Co.LTD
High Quality triple candy vending machine for salesUSD $ 75.00 - 75.00
>=700 Piece
Meo Textile Clothing Co.LTD
TCN brand snacks and beverage mini vending machine businessUSD $ 1,000.00 - 2,000.00
>=1 Piece
Meo Textile Clothing Co.LTD
Lil Wizard Spiral Vending Mechanical Gumball Machine for Bubble Gum, CandyUSD $ 120.00 - 140.00
>=20 Piece
Meo Textile Clothing Co.LTD
vending machine make more money with ad~design your own new customized eco-friendly business mineral or hydrogen or RO waterUSD $ 1,199.00 - 2,499.00
>=2 Unit
Meo Textile Clothing Co.LTD
SNBC BVM-RI300 New Business Ideas Vending Machine For Foods And Drinks Flowers Black Vending Machine For Sale CosmeticsUSD $ 4,500.00 - 4,500.00
>=1 Set
Meo Textile Clothing Co.LTD
High Quality Automatic Electronic Card Dispenser Machine for Parking Charge Vending MachineUSD $ 100.00 - 130.00
>=1 Unit
Meo Textile Clothing Co.LTD
Aluminum Alloy body Square container candy gumball dispenser vending machineUSD $ 33.00 - 38.00
>=10 Piece
Meo Textile Clothing Co.LTD
Wall-mounted 24 Hours Self-service Skin Care Vending Machine Face Mask Vending Machine Surgical Mask Vending MachineUSD $ 270.00 - 330.00
>=1 Unit
Meo Textile Clothing Co.LTD
Touch Screen Self Smart Instant Noodle Vending Machine BusinessUSD $ 1,000.00 - 5,500.00
>=1 Unit
Meo Textile Clothing Co.LTD
Forkwin Gumball Machine with Candy Capacity Dispenser Capsule gift Red Candy Vending Machine for Home use BusinessUSD $ 36.00 - 40.50
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Gift Card Vending Machine RFID and SIM Electronic Card Card DispenserUSD $ 100.00 - 130.00
>=1 Unit
Meo Textile Clothing Co.LTD
New Series Floor Standing Business Photo Booth With Printer Vending KioskUSD $ 1,299.00 - 2,699.00
>=1 Piece
Meo Textile Clothing Co.LTDRelated Searches:
bianchivendingmachinevendingmachinebusinessforsalenearmenayaxcardreadertopvendingmachinecompaniesgiftcardvendingmachineskittlesvendingmachineforsalesimcardvendingmachinevendingmachinesforsaleebayicevendingmachinebusinessforsalecontactlessvendingmachineforsalevendingmachinelocatorspepsimachinescoffeedaymachinecostantiquecocacolamachinevendingsupplyusedcombovendingmachinesmechanicalvendingmachinewatervendingvendopepsimachinehotvendingmachinesnectacoffeemachinepriceeyelashvendingmachinevendingsystematlantiscoffeevendingmachinecoffeevendomachineforsalenestlecoffeevendingmachinesmallsnackvendingmachinefrozenfoodvendingmachinescoinoperatedcandydispensercommercialvendingmachine