Welcome to TradeChina
2020 hotsale cute animal white cat ceramics mini artificial succulent plants potUSD $ 1.14 - 1.18
>=500 Piece
Meo Food Co., Ltd.
BAVA high quality solar powered 240w samsung lm301b 4000k uv ir 4 channel garden led grow light for veggies plantsUSD $ 170.00 - 190.00
>=1 Set
Meo Food Co., Ltd.
Natural plants transparent clear vegetable cellulose Empty HPMC vegan Capsules Size 00 0 1 2USD $ 0 - 0
>=10000 Piece
Meo household Co.LTD
Goodies plant based and veggies proteins for good health and allergenic dog treat or food lamb, milk, chicken liver tripleUSD $ 2.55 - 2.95
>=500 Bag(s)
Meo Food Co., Ltd.
cheap Outdoor Growing Fresh Veggies Flowers and Herbs Garden Bed Box Vegetable PlanterUSD $ 19.90 - 35.50
>=500 Piece
Meo Food Co., Ltd.
Hydroponic Growing Black 4/6/8 Tier Layer Collapsible Round Stackable Herb Drying Racks Plant Drying NetUSD $ 6.59 - 10.49
>=2 Piece
Meo Food Co., Ltd.
Customized Natural Plants Vegetable Cellulose Empty Printed HPMC Capsules Size 0# 1# 2# 3# 4# 00#USD $ 4.20 - 4.40
>=100000 Grain
Meo household Co.LTD
Empty Plant Capsules For Vegetarian,Vegetable Gelatin Empty Veggie CapsulesUSD $ 250.00 - 300.00
>=1 Case(s)
Meo household Co.LTD
Clear Vegetable Cellulose Empty Hpmc Vegan Capsules Transparent SN Natural Halal Certificated Empty Gelatin Capsule Shell PlantsUSD $ 0 - 0.01
>=10000 Piece
Meo household Co.LTD
Heavy-duty polyethylene Garden Trellis Netting Plant Support Grow Net Vine and Veggie Trellis NetUSD $ 0.04 - 0.13
>=1000 square meter
Meo household Co.LTD
OEM Multiple bio-enzyme, plant-based Fruits and Veggie WashUSD $ 1.00 - 2.00
>=10000 Piece
Meo Food Co., Ltd.
MET 20"X20.75" Waterproof Seedling Heat Mat Ip67 Waterproof Plant Warm Cushion for Seed Propagation and Increased GerminatUSD $ 3.00 - 3.00
>=100 Piece
Meo Food Co., Ltd.
Greenhouse Breathable Vegetable Fabric Plant Pot Potato Tomato Grow BagsUSD $ 1.00 - 3.00
>=200 Piece
Meo Food Co., Ltd.Related Searches:
chicoryseedwildblueberrybushcactuspearwhitemulberryleafsweetmelonplantmiraclegroplantfoodspikescheeseplantsweettamarindtreevegetablegardendragonfruitplantforsalelotusseedsforplantinggrowingvegetablesinpotsforbeginnersmiraclegrospikeslambhassavocadotreetreefoodspikesgreenonionplantpricklypearflowerplantingpotatoesinbagsplantingdateseedstoppingtomatoplantspotassiumplantfoodbestcontainervegetablespechayseedspassiflorafruitcoconuttreeseedgrowingsunflowerseedsbabybananatreeavocadotreeflowergrowingpumpkinseedsmucunabeans