Welcome to TradeChina
RELATED CATEGORIES:
Professional Manufacturer Protein Syrup Mascara Eyelash Juice Cup Pudding Hot Filling MachineUSD $ 1,550.00 - 1,650.00
>=1 Set
Meo Textile Clothing Co.LTDSemi Automatic Pneumatic Bottling Machine Heating Device For Hot Paste Bottle Filling MachineUSD $ 1,550.00 - 1,650.00
>=1 Set
Meo Textile Clothing Co.LTDPneumatic Stirring With Heating Function And Mixing Pomade Hot Fruit Slurry Paste Filling MachineUSD $ 1,550.00 - 1,650.00
>=1 Set
Meo Textile Clothing Co.LTDCE Standard Pneumatic Double Head Heating Device For Hot Chili Sauce Paste Bottle Filling MachineUSD $ 1,550.00 - 1,650.00
>=1 Set
Meo Textile Clothing Co.LTD
automatic 800-1000per hour calippo packaging filling machine calippo ice cream cup filling and sealing machineUSD $ 4,590.00 - 4,590.00
>=1 Set
Meo Textile Clothing Co.LTD
OEM AP400 air cushion machine air cushion packaging machine air bubble machineUSD $ 598.00 - 628.00
>=1 Piece
Meo Textile Clothing Co.LTD
Automatic paste filling machine and multi-station depositor for cake and cake making machine dough fillerUSD $ 8,000.00 - 16,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Standing Pneumatic Cosmetic Cream Heating Mixing Filling Machine For Small BusinessUSD $ 1,200.00 - 2,500.00
>=1 Set
Meo Textile Clothing Co.LTD
Pure Water Cup Filling And Sealing MachineUSD $ 2,000.00 - 12,500.00
>=1 Set
Meo Textile Clothing Co.LTD
Small Factory Manual Ketchup Cream Liquid Filling Machine for Lotion Shampoo Detergent Mayonnaise Tomato SauceUSD $ 250.00 - 500.00
>=1 Set
Meo Textile Clothing Co.LTD
ice cream in a box filling machine production lineUSD $ 25,000.00 - 25,000.00
>=1 Set
Meo Textile Clothing Co.LTD
CE 1000-30000bph packing factory design Complete automatic mineral water machine projectUSD $ 20,000.00 - 20,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Butter Cake Depositing Bread Stuffing Automatic Filling Machine For Ice CreamUSD $ 1,200.00 - 6,900.00
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
vaselineintensivecareessentialhealingpetroleumjellyforskinrashesvaselinepetroleumjelly100mlvaselineintensivecareadvancedrepaireczemavaseline600mlpetroleumjellyfordrylipsvaselinefortattooaftercarevaselinetotalmoisturecocoaglowvaselineskinjellyvaseline100mlparaffinvaselinevaselinecostvaselineintensivecarehealthybodyglowvaselineintensivecare400mlpricevaselinealoesoothealoeverapetroleumjellyvaselineantiacnevasocarevaselineoriginalpetroleumjellyvaselinesetnewvaselinevaseline200mlvaselineskinwhiteningvaselineeyelashvaselinepetroleumjellyonlinevaseline250mlpricepetroleumjelly1kgpricevaselinebodylotionsvaselinemenextrastrengthvaselineintensivecarealoesoothe400ml