Welcome to TradeChina
Health Care Supplement Protien Powder Organic Whey Protein PowderUSD $ 7.00 - 10.00
>=100 Unit
Meo Auto Parts Co.LTD
ISO Manufacture CAS 84082-51-9 WPC Whey Protein Concentrate PowderUSD $ 3.50 - 9.00
>=10000 Kilogram
Meo Auto Parts Co.LTD
Top Purity vanilla milk shakes customize whey protein powderUSD $ 13.84 - 21.53
>=1 Kilogram
Meo Auto Parts Co.LTD
Optimum Nutrition Gold Standard 100% Whey Protein All Flavors and Other Supplements !USD $ 7.00 - 10.00
>=100 / unit
Meo Auto Parts Co.LTD
Premium Optimum Nutrition Whey Protein 100% Gold StandardUSD $ 7.00 - 10.00
>=100 Unit
Meo Auto Parts Co.LTD
Top Purity health concentrate whey protein isolateUSD $ 13.84 - 21.53
>=1 Kilogram
Meo Auto Parts Co.LTD
Custom Printed Aluminum Foil Standup Pouch Gold Standard Whey Protein Powder Bag with ZiplockUSD $ 0.03 - 0.08
>=5000 Piece
Meo household Co.LTD
Customized Aluminum Foil with Airtight Zipper Whey Protein Isolate Powdered Milk Packaging BagUSD $ 0.04 - 0.15
>=2000 Piece
Meo household Co.LTD
100% Food Grade Whey Protein Eight Side Seal Square Block Flat Bottom Gusset Pouch Bags with ZipperUSD $ 0.01 - 0.08
>=10000 Piece
Meo household Co.LTD
Aluminum Foil Whey Protein Bag For Sport Supplement With Ziplock Top(Customized Printing)USD $ 0.23 - 0.25
>=20000 Piece
Meo household Co.LTD
Custom logo aluminum foil packaging printed stand up whey protein powder ziplock bagUSD $ 0.03 - 0.03
>=10000 Bag(s)
Meo household Co.LTD
Custom printed 1kg whey protein powder foil stand up pouchUSD $ 0.05 - 0.07
>=10000 Piece
Meo household Co.LTD
Moisture Proof Aluminum Foil Food Grade Whey Powder Protein Powder PackagingUSD $ 0.04 - 0.10
>=5000 Piece
Meo household Co.LTD
10X20cm Kraft paper bag for milk powder/whey protein/flour/riceUSD $ 4.21 - 4.39
>=4 Pack
Meo household Co.LTD
Custom Printing zipper corn loose tea bag food grade eco biodegradable whey protein powder pouch bagsUSD $ 0.03 - 0.30
>=10000 Piece
Meo household Co.LTD
2016 High Quality custom printing wholesale plastic bottle, container for whey protein powderUSD $ 0.03 - 0.09
>=5000 Piece
Meo household Co.LTD
custom print plastic whey protein powder packaging plastic bagUSD $ 0.01 - 0.09
>=30000 Piece
Meo household Co.LTD
Wholesale customized resealable whey protein powder packaging bags stand up food pouches food packaging bagsUSD $ 0.03 - 0.14
>=200 piec
Meo household Co.LTD
High Quality Semi automatic small Dry Powder Filling Machine Whey Protein PowderUSD $ 5,000.00 - 10,000.00
>=1 Set
Meo Textile Clothing Co.LTD
popular bag type custom printed 500g 1kg flat bottom mylar foil lined whey protein shake powder plastic packaging zipper bagUSD $ 0.05 - 0.50
>=10000 Piece
Meo household Co.LTD
Powder Grade Stand Up Pouch Whey Protein Powder Packaging Zipper Pouch Metalized Standing up Custom Food Packaging Pouch ZiptopUSD $ 0.05 - 0.09
>=1000 Bag(s)
Meo household Co.LTD
Milk Whey Protein Powder Silver Aluminum Foil Matte Finish Ziplock Packaging Stand Up Pouch Plastic Pouch SachetUSD $ 0.01 - 0.08
>=1000 Piece
Meo household Co.LTD
Custom Printed Resealable plastic Whey Protein ziplock Powder side gusset Bag for milk powderUSD $ 0.30 - 0.80
>=3000 piec
Meo household Co.LTD
Aluminum Foil Stand up Pouch, 500g 1kg Whey Protein Powder Packaging Bag with ZipperUSD $ 0.02 - 0.10
>=500 Piece
Meo household Co.LTD
Customized stand up flat bottom whey protein powder pouch bag with Slider zipperUSD $ 0.04 - 0.08
>=100 Bag(s)
Meo household Co.LTDRelated Searches:
perfectwheywheyproteinadvancedwheygainerhimalayawheyproteinproteinshakeswithoutwheygrassfedwheyproteinoptimumnutritionwheyisolatetop10wheyproteinisolatebpiwheyproteinnitrowheyproteingoldwheyimpactwheyproteinmilkteaon100wheygoldstandardwheyproteinwalmartprecisionengineeredwheyproteinwheyconcentratembwheyproteinwheyproteinforwomenwheyprotein1kgwheyproteinpowderasitiswheymuscletechnitrotechpurewheyproteinwheydymatizeonwhey10lbsbestwheyproteinbrandtop10wheyprotein2018impactwheyprotein5kgoptimumnutritiongoldstandardwheyproteinpowderveganwheyproteinwheyisolateprice