Welcome to TradeChina
RELATED CATEGORIES:
Machine sealing band plastic tea bags for sale with good priceUSD $ 300.00 - 450.00
>=1 Piece
Meo Textile Clothing Co.LTD
Ultrasound Sealing Nylon Teabag Packing Machine Ultrasonic cutting triangle bags packaging equipment teaUSD $ 9,990.00 - 12,390.00
>=1 Set
Meo Textile Clothing Co.LTD
Well stocked pyramids tea bag with string tag sri lanka price tea packing machineUSD $ 10,000.00 - 13,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Loose Tea Leaf Packing Machines Price, Small Filter Paper Tea Bag Packing MachineryUSD $ 5,000.00 - 5,900.00
>=1 Set
Meo Textile Clothing Co.LTD
Automatic small tea bag/ filter paper tea powder sachet pouch packing machineUSD $ 7,700.00 - 8,400.00
>=1 Set
Meo Textile Clothing Co.LTD
Ziplock bag oats with coix seed milk tea latte moringa leaf powder packaging machine ladies soybean drink powder pouch pre-madeUSD $ 12,850.00 - 12,850.00
>=1 Set
Meo Textile Clothing Co.LTD
Ce Approval Bubble Tea Tin Can Capping Machine Can SealerUSD $ 2,800.00 - 3,050.00
>=1 Set
Meo Textile Clothing Co.LTD
CE Approved Automatic Snack/ Nut/ Candy /Loose Leaf Tea PreMade Bag Packing MachineUSD $ 28,000.00 - 28,000.00
>=1 Set
Meo Textile Clothing Co.LTD
SC-7902 High quality good price tea cafe vending machine for small officeUSD $ 1.00 - 170.00
>=50 Piece
Meo Textile Clothing Co.LTD
China manufacture wholesale price new design best selling scent fragrance machineUSD $ 78.00 - 99.00
>=2 piec
Meo Food Co., Ltd.
TCN automatic instant coffee tea vending machine coffee vending machine priceUSD $ 3,719.00 - 3,719.00
>=3 Set
Meo Textile Clothing Co.LTD
Protaylor industrial commercial office use ice cube making machine priceUSD $ 299.00 - 299.00
>=2 Piece
Meo Textile Clothing Co.LTD
Direct Supplier Price Cold Air Diffusion Technology CH122 HVAC Hotel Scent Machine for Fragrance MarketingUSD $ 60.00 - 115.00
>=1 Piece
Meo Food Co., Ltd.
Factory Price Modern Fresh Air Fan, High Quality Reed Diffuser, Hot Selling Air Freshener MachineUSD $ 4.49 - 5.99
>=300 piec
Meo Food Co., Ltd.
OEM Custom color changing sublimation blank mugs magic mug machine heart change With Low PriceUSD $ 1.50 - 1.80
>=36 piec
Meo Food Co., Ltd.
Exporter of Office Use Instant Tea Coffee Vending Machine at Low PriceUSD $ 140.00 - 520.00
>=1 Set
Meo Textile Clothing Co.LTD
Factory Price Handheld Electorstatic Smoke/ Fogg Sprayer Fogging MachineUSD $ 18.50 - 19.50
>=2 piec
Meo Food Co., Ltd.
Manufacturer pp non-woven fabric reusable k cup coffee filter for capsules packing machineUSD $ 0.02 - 0.04
>=100000 Piece
Meo Food Co., Ltd.
cheap price Portable Electric Handheld fogging machines wireless mini Nano Spray Gun with batteryUSD $ 13.50 - 17.50
>=1 Piece
Meo Food Co., Ltd.
JOYBOS Factory high quality EU Certification apple potato lemon peelers stainless steel plastic peelersUSD $ 2.50 - 3.00
>=1 Piece
Meo Food Co., Ltd.
Factory price home table top reverse osmosis system direct drinking UVC RO water filter water_purifier_machineUSD $ 232.60 - 272.20
>=2 Set
Meo Advertising Co.LTD
Factory in stock handheld sanitizing machine price portable nano atomizer street garden home fog sanitizer fogger machineUSD $ 32.00 - 38.00
>=10 piec
Meo Food Co., Ltd.
Low Price ULV005 Knackpack Electric Sprayer 12L Fog Machine 110V/220V ULV Fogger for Home and Office Disinfection ULV FoggerUSD $ 70.00 - 79.00
>=50 piec
Meo Textile Clothing Co.LTD
Electric Water Dispenser Drinking Fountain Machine Cold & Hot Water Cooler Heater Home Office Hostel Coffee Tea Bar HelperUSD $ 40.00 - 50.00
>=270 Piece
Meo Advertising Co.LTD
High Mixing Speed Commercial Protein Shake Vending Machine For Gym And Athletics CentreUSD $ 1,500.00 - 2,500.00
>=1 Set
Meo Textile Clothing Co.LTD
Cheap price electronic good quality coffee machine with USB rechargeable coffee milk frotherUSD $ 4.20 - 5.60
>=100 Piece
Meo Food Co., Ltd.
Cheap price compact portable sterilization disinfection smoke fogging machine sprayer mistUSD $ 47.00 - 70.00
>=2 piec
Meo Food Co., Ltd.
Office use instant coffee vending machine ,used instant coffee vending machine price ,instant coffee tea drink vending machineUSD $ 380.00 - 500.00
>=1 Set
Meo Textile Clothing Co.LTD
large complete automatic commercial stainless steel coffee maker machine filter and percolator equipment for commercial purposeUSD $ 19.65 - 27.50
>=1 piec
Meo Advertising Co.LTD
cheap price electric automatic cigarette rolling machine tobaccoUSD $ 5.49 - 6.78
>=5 piec
Meo Food Co., Ltd.
Portable Coffee Hot Chocolate Powder Drink Vending Machine with Office UseUSD $ 230.00 - 400.00
>=2 Set
Meo Advertising Co.LTD
Jereh oem portable handheld electrostatic sprayer electric disinfection spray gun fog machine prices alcohol sprayerUSD $ 619.00 - 769.00
>=10 piec
Meo Food Co., Ltd.
CE Certification customizable price car disinfectant ulv fogger machineUSD $ 270.00 - 280.00
>=1 piec
Meo Food Co., Ltd.
2021 Best selling hot chinese products n2o cream chargers filling machine at low priceUSD $ 10.80 - 12.80
>=4320 Piece
Meo Food Co., Ltd.
Hot sale dinnerware cheap price machine made BPA free in stock small MOQ round Pink color Edge Glass Charger all purpose plateUSD $ 2.40 - 3.00
>=24 Piece
Meo Food Co., Ltd.
Price Philippines Tablets Making Machines Automatic Mixer Machine Hanging Deodorizing Toilet Bowl Bleach Cleaner Tablet 100GUSD $ 0.20 - 0.25
>=2000 Piece
Meo Food Co., Ltd.
factory price cup noodle vending machine commercial instant portable coffee vending machine for saleUSD $ 800.00 - 2,500.00
>=1 Set
Meo Textile Clothing Co.LTD
Stainless Steel Silicone Smoothie Custom Shaped Seaweed Roll Price Of Tatami Mats Japanese Paper Making Machine From Rice StrawUSD $ 0.85 - 1.00
>=1000 Piece
Meo Food Co., Ltd.
water creative customized arabic stainless steel tea pot with infuser original factory price tea potUSD $ 4.78 - 5.78
>=1 piec
Meo Food Co., Ltd.
2021 hot sale high speed cheap price cold press portable machine juicerUSD $ 9.50 - 12.00
>=2 Piece
Meo Food Co., Ltd.
factory price disposable paper coffee store printed logo double wall hot coffee vending machine cupsUSD $ 0.04 - 0.05
>=10000 Piece
Meo household Co.LTD
Factory cheap price design luxury sets with rugs gold shower curtain hotel quality machine washableUSD $ 2.80 - 3.50
>=100 Piece
Meo Food Co., Ltd.
professional Factory Wooden Stick For Broom Poles Brush brooms Making Machine Price broomstick escobasUSD $ 0.11 - 0.12
>=5000 piec
Meo Food Co., Ltd.
16lKnapsack hand sprayer used for agricultural with best priceUSD $ 3.99 - 5.99
>=100 piec
Meo Food Co., Ltd.
Cheap price new model milk frother machine with 2 AA Battery for milk and coffeeUSD $ 3.80 - 6.50
>=400 Piece
Meo Food Co., Ltd.
coffee vending machine outdoor fully automatic commercial coffee making machine priceUSD $ 799.00 - 2,500.00
>=1 Set
Meo Textile Clothing Co.LTD
OneCapsule tea and capsule coffee vending machine with high reliabilityUSD $ 4,000.00 - 4,570.00
>=1 Unit
Meo Textile Clothing Co.LTD
Manufacturer Wholesale Restaurant Hotel Crockery Tea Cup Set Saucer Factory Good Price Cafe Porcelain Ceramic Coffee CupUSD $ 2.30 - 2.60
>=16 piec
Meo Food Co., Ltd.
10L Backpack Agricultural Sprayer Machine Intelligent ULV Smoke Mist Sprayer Disinfecting Fogging Machine Sprayer for SanitizingUSD $ 82.00 - 82.00
>=1 Piece
Meo Food Co., Ltd.
AUPLEX Direct Wholesale Price Outdoor Red 24'' Ceramic Kamado Egg For Garden PartyUSD $ 320.00 - 400.00
>=1 Set
Meo Food Co., Ltd.Related Searches:
vendingmachinesforsaleebaytopvendingmachinecompaniessmallsnackvendingmachinebestcoffeevendingmachinesbestsellingvendingmachinecandyvintagesodamachinesforsalepizzafornovendingmachineeyelashvendingmachinedrinkmachinenearmelypcgumballmachineautomaticchocolatevendingmachinesweetdispensermachinepopvendingmachineforsaleicevendingmachinebusinesscontactlessvendingmachineforsalelaysvendingmachinesilentsalesforcegumballmachinelocalvendingmachinecompaniesbubblegumvendingmachinecandyvendingmachinebusinessvendingcoffeenescafecoffeevendingmachinepricekoolericemachineforsaleusedsodavendingmachinesforsalenearmemeivendingmachinedrinkvendingmachinenearmecarddispensermachineintelligentvendingmachinepepsimachinesvendingmachinelocators