Welcome to TradeChina
RELATED CATEGORIES:
Anti Scratch Transparent Car Paint Protection Film Sticker 1.52*15m PPFUSD $ 380.00 - 420.00
>=10 Roll
Meo Bio Energy Sales Co.LTD
optically clear adhesive film Paint Protection Film Top CoatedUSD $ 78.50 - 157.00
>=10 Roll
Meo Bio Energy Sales Co.LTD
PPF Paint Protection Film Car TPU film car paint protection filmUSD $ 400.00 - 420.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Matte PPF Self Healing Coating Car Paint Protection Wrap Vinyl FilmUSD $ 99.00 - 175.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Factory Supply Anti Scratch Wrap Car Paint Protection Film Self RestoreUSD $ 600.00 - 600.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
1.52*15m High BLACK PPF TPH Film Car Paint ProtectionUSD $ 143.00 - 170.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Plastic Roll Lldpe Stretch Wrap Paint Protection FilmUSD $ 0.26 - 1.15
>=200 Kilogram
Meo household Co.LTD
PVC material color vinyl Car Wrap Vinyl for Car Protective paint protection filmUSD $ 170.00 - 200.00
>=10 Roll
Meo Bio Energy Sales Co.LTD
Customized self healing transparent protection ppf film,car paint protection wrapUSD $ 486.00 - 550.00
>=2 Roll
Meo Bio Energy Sales Co.LTD
High Quality Self-adhesive Car Wrap Vinyl Paint Protection Film For Body CareUSD $ 360.00 - 380.00
>=10 Roll
Meo Bio Energy Sales Co.LTD
3 layers Car Invisible PPF Clear mirror Vehicle vinyl Paint Protection Films wrap carUSD $ 45.00 - 63.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
KPAL Great Quality Self healing Tph Ppf Matte,Car Ppf Paint Protection Film Ppf,Car Ppf FilmUSD $ 200.00 - 240.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
1.52m*15m/roll TPH Paint protection film PPF for car self healing clear anti scratchUSD $ 165.00 - 180.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Fast delivery 3 Layers PPF car film clear protective vinyl wrap body ppf paint protection film for auto body TPH TPU paint filmUSD $ 128.00 - 128.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
SULAMEDER Automotive Vinyl Paint Protection Film Car Wrap self adhesive film tpu ppf filmUSD $ 300.00 - 300.00
>=100 Roll
Meo Bio Energy Sales Co.LTD
1.52*15m PPF- TPH transparent paint protection film self healing anti scratch protective car body stickerUSD $ 180.00 - 195.00
>=2 Roll
Meo Bio Energy Sales Co.LTD
Anti acid rain erosion 1.52*15 m Full Size Black PPF Anti Scratch Car Paint Protection Vinyl Wrap FilmUSD $ 119.00 - 169.00
>=2 Roll
Meo Bio Energy Sales Co.LTD
NICK S-90 paint protection film ppf for carsUSD $ 585.00 - 645.00
>=10 Roll
Meo Bio Energy Sales Co.LTD
Manufacturer Auto PPF Paint Protection Film Car Wrap Nano Film Car Vinyl Sticker Transparent Vinyl Film For Car 0.3*20mUSD $ 145.00 - 165.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Dustproof polythene clear film for furniture covers 3m paint protection film cover sheetUSD $ 0.19 - 0.25
>=8000 piec
Meo household Co.LTD
Top Coating Super Hydrophobic Paint Protection film 1.5x15m/roll 8milUSD $ 530.00 - 600.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
New arrive top quality paint protection film for carUSD $ 598.00 - 650.00
>=2 Roll
Meo Bio Energy Sales Co.LTD
Economic Paint Protection film ultra cap TPH PPF 1.5X15MUSD $ 150.00 - 160.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
2021 New Arrival Anti-Scratch Transparent Car Wrap Vinyl Stain Resistance PPF TPU Paint Protection Film fOr CarUSD $ 630.00 - 650.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Newest Black TPH/TPU Paint Protection Film / High Quality Black PPFUSD $ 140.00 - 150.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
3M Paint Protection Film for Aluminum Composite PanelUSD $ 600.00 - 600.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
PPF manufacturer matte ppf paint protection foil car wrap film 1.52*15M TPU for car bodyUSD $ 600.00 - 620.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
1.52*15M Transparent Auto Clear PVC Paint Protection FilmUSD $ 50.00 - 150.00
>=2 Roll
Meo Bio Energy Sales Co.LTD
SINOVINYL TPH Super Transparent Clear Paint Protection Film For CarUSD $ 280.00 - 300.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Free Shipping Gloss PVC Self-healing Car Body Clear Paint Protection FilmUSD $ 218.00 - 259.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Paint protection film scratch protection film car body wrapUSD $ 200.00 - 240.00
>=5 Roll
Meo Bio Energy Sales Co.LTD
TPU transparent paint protective double coating wrap vinyl for car sticker ppf tpu paint protection film manufacturerUSD $ 139.00 - 145.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Car Wrapping Paint Protection film, transport protective film for for freshly painted car bodies, Anti-UV for 6 monthsUSD $ 80.00 - 82.00
>=50 Roll
Meo Bio Energy Sales Co.LTD
1.52*15m roll high stretch self healing anti yellow car wrap paint protection film foil in TPU TPH PVCUSD $ 8.90 - 8.90
>=15 Meter
Meo Bio Energy Sales Co.LTD
Korea quality best price coating PPF film glossy TPH TPU car paint protection film with size in 1.52*15m rollUSD $ 128.00 - 128.00
>=2 Roll
Meo Bio Energy Sales Co.LTD
Suntek Quality Top Coating TPU PPF Car Wrap Vinyl Paint Protection Film For Car BodyUSD $ 549.00 - 649.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
USA quality 8mil 12mil 60"*15m TPH TPU nano ceramic coating anti scratch car paint protection film car body paint wrap filmUSD $ 129.00 - 140.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
PPF Tpu 3 layers China paint protection film supplier size 1.52*15m anti scratch ppfUSD $ 450.00 - 450.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Self healing Car paint protection film TPU PPFUSD $ 400.00 - 600.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Self-healing TPU Material Paint Protection Film Anti-yellow Protective Film PPFUSD $ 25.00 - 25.00
>=15 Meter
Meo Bio Energy Sales Co.LTD
1.52*15m Size Anti yellow Anti-scratch ppf hydrophobic film with TPU for car bodyUSD $ 340.00 - 390.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
High Glossy Polymeric PVC Free Sample TPH PPF Roll Vinyl Stickers Paint Protection Film White Release PaperUSD $ 3.50 - 4.10
>=22 square meter
Meo Bio Energy Sales Co.LTD
paint protection film stick on the surface of car ppf tpu tph antiscratch ppf car body clear paint protection filmUSD $ 98.00 - 136.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
TPU Materia Super Transparent Clear Paint Protection Film For CarUSD $ 548.00 - 598.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Smart Photochromic tint film 1.52*15m stretchable self healing TPU Paint protection film PPF for car motorcycleUSD $ 980.00 - 1,000.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Anti scratch anti yellow PU Paint Protection Film PPF Car Film ProtectionUSD $ 185.00 - 250.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
xpel 1.52*15m self adhesive anti scratch water proof uv99 coating car body protector invisible ppf tpu paint protection filmUSD $ 495.00 - 540.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Anolly Good quality paint protection film self adhesive vinyl for car warping filmUSD $ 65.00 - 70.00
>=1 Roll
Meo Bio Energy Sales Co.LTD
Verified Manufacturer no residue self adhesive plastic pe paint surface protection filmUSD $ 0.18 - 0.21
>=10000 Meter
Meo household Co.LTDRelated Searches:
paintprotectionfilmpricellumarcarwrap3mclearbrainstallerclearbracarinstallationnearme3mclearvinyl3mscotchgardclearpaintprotectionbulkfilmrollclearwrappaintprotectionclearbraautopaintprotectionxpelcarwrapnearmetransparentpaintprotectionfilmpaintprotectionfilmforsaleclearmattewrapcarbestpaintprotectionfilm2019sprayoncarbrappffrontbumpercostpaintprotectionfilmsolutionclearcarwrapnearmeclearvinylwrapcartoyotapaintprotectionfilmautoclearbra3mclearbratapesuntekpaintprotectionpaintchipprotectionbestclearwrapforcarclearcarbrainstallers3mscotchgardpaintprotectionfilmproseriesxpelppffilmclearfilmforcarsppfcarcoatingcostofprotectivefilmoncar