Welcome to TradeChina
HOT Sale Commercial Coffee Vending Machine with 3 Flavor DrinksUSD $ 229.00 - 400.00
>=2 Set
Meo Textile Clothing Co.LTD
Raspberry Pi Wiegand QR Bar Code Reader Module Vending Machine Barcode Scanner ModuleUSD $ 62.00 - 75.00
>=2 piec
Meo Textile Clothing Co.LTD
Customize CNC Machining Popcorn Coin Part Coffee Vending Machine Spare PartsUSD $ 90.00 - 90.00
>=10 piec
Meo Textile Clothing Co.LTD
One touch automatic espresso cappuccino commerical coffee vending machineUSD $ 300.00 - 450.00
>=1 piec
Meo Textile Clothing Co.LTD
Automatic Cup Dispenser Coffee Vending Machine for Foods and DrinksUSD $ 1,000.00 - 2,999.00
>=1 Set
Meo Textile Clothing Co.LTD
New 2021 Guangdong coffee tea big vending machineUSD $ 1,514.00 - 1,978.00
>=1 Piece
Meo Textile Clothing Co.LTD
AFEN automatic instant drink tea soup mini hot and ice coffee vending machine with cash credit card coin acceptorUSD $ 1,000.00 - 1,150.00
>=1 Set
Meo Textile Clothing Co.LTD
vending machines condom drink cosmetic coffee smart self service store candy food vending custom vending machineUSD $ 888.88 - 1,111.11
>=1 piec
Meo Textile Clothing Co.LTD
smart touch screen mini small mask coffee snack water vending machine automatic for saleUSD $ 200.00 - 200.00
>=500 Set
Meo Textile Clothing Co.LTD
auto tea and coffee vending machine with 2 drinksUSD $ 170.00 - 170.00
>=30 piec
Meo Textile Clothing Co.LTD
Best Price Automatic Nescafe Tea Coffee Vending Machine For Market 220vUSD $ 650.00 - 650.00
>=1 Set
Meo Textile Clothing Co.LTD
2020 automatic black white hot chocolate tea coffee vending machineUSD $ 2,600.00 - 2,999.00
>=1 Set
Meo Textile Clothing Co.LTD
Hot drinks 1600W, trendy vending machine/automatic tea coffee vending machineUSD $ 200.00 - 1,000.00
>=1 Piece
Meo Textile Clothing Co.LTD
Gym Fitness Club Use Standing Protein Shake Cold Drink Vending MachineUSD $ 850.00 - 2,200.00
>=5 Piece
Meo Textile Clothing Co.LTD
better than india coffee and tea vending machine, best selling in Bangladesh vending machine WF1-202BUSD $ 140.00 - 180.00
>=1 piec
Meo Textile Clothing Co.LTD
March Expo New Arrival Coffee Vending Machine LE303VUSD $ 180.00 - 230.00
>=10 piec
Meo Textile Clothing Co.LTD
Wifi touch screen advertising display snack pizza coffee vending machineUSD $ 2,000.00 - 3,000.00
>=1 Set
Meo Textile Clothing Co.LTD
instant hot cold coffee vending machine with non coin-operated funtionUSD $ 500.00 - 750.00
>=1 Set
Meo Textile Clothing Co.LTD
Coin operated turkish coffee vending machine with factory priceUSD $ 220.00 - 320.00
>=1 Unit
Meo Textile Clothing Co.LTD
Coffee/tea/cola mini mart vending machineUSD $ 3,500.00 - 5,500.00
>=1 Set
Meo Textile Clothing Co.LTD
Best Price Automatic Nescafe Tea Coffee Vending Machine For China Market 220vUSD $ 350.00 - 810.00
>=1 Set
Meo Textile Clothing Co.LTD
Coin Operated Mini Automatic Coffee Vending Machine 3 Flavors of Hot Drinks Small Digital Led Display Buckets on TopUSD $ 200.00 - 320.00
>=1 Unit
Meo Textile Clothing Co.LTD
You deserve to have vending machine/juice machineUSD $ 200.00 - 1,000.00
>=1 Piece
Meo Textile Clothing Co.LTDTCN Hot sales Automatic coffee vending machineUSD $ 2,580.00 - 3,150.00
>=1 Set
Meo Textile Clothing Co.LTD
Best selling in Bangladesh India Phillippine coffee vending machine WF1-303AUSD $ 160.00 - 200.00
>=1 Piece
Meo Textile Clothing Co.LTD
8 touch button coffee vending machine WF1-303AUSD $ 160.00 - 200.00
>=1 piec
Meo Textile Clothing Co.LTD
ISO90012008 Coffee Vending Machine in Hot SellingUSD $ 600.00 - 1,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Barsetto Semi-Auto commercial espresso grinder coffee machine bean italian vending 2 group coffee maker espressoUSD $ 571.00 - 670.00
>=2 piec
Meo Advertising Co.LTD
Full automatic triangle tea-bag packing machine for tea ,coffee,granule materialUSD $ 15,000.00 - 16,000.00
>=1 Set
Meo Textile Clothing Co.LTD
Instant Tea Coffee Vending Maker Small Commercial Desktop Machines Coffee Vending Machines with Cup Dispenser Cafe MachineUSD $ 308.75 - 308.75
>=2 acr
Meo Textile Clothing Co.LTD
19" LCD Advertisement Vending Coffee Machine Commercial Coffee Machine Powder drink VendingUSD $ 480.00 - 1,200.00
>=8 Piece
Meo Advertising Co.LTDRelated Searches:
watervendingcoldfoodvendingmachinesdrinkmachinenearmeexpendingmachineusedsodavendingmachinesforsalenearmefrozenvendingmachineautomaticcoffeevendingmachinequartercandymachinevendingmachinebusinessforsalenearmevendingsystemgachavendingmachinecappuccinovendingmachinebubblegumvendingmachinecoffeedaymachinecostnorthwesternvendingmachineslocalvendingmachinecompaniesautomaticchocolatevendingmachinebusinesseslookingforvendingmachinesbeervendingmachineforsalecoffeepremixforvendingmachinecafecoffeedayvendingmachinepricegumvendingmachineskittlesvendingmachineforsalenectacoffeemachinepricegiftcardvendingmachinesweetdispensermachinenestlecoffeevendingmachinecarddispensermachineintelligentvendingmachinesodacanmachine