Welcome to TradeChina
RELATED CATEGORIES:
Cheap Dumbbells Weight Lifting Non-slip Grip Soft Neoprene Dumbbell SetUSD $ 23.20 - 24.30
>=50 Pound
Meo Electronic Technology Co.LTD
Factory Outlet Plating Weight Lift Dumbbell Combination Set Dumbbell Gift BoxUSD $ 20.90 - 46.90
>=20 Set
Meo Electronic Technology Co.LTD
Widely Used Heavy Dip Weight Lifting Neoprene BeltUSD $ 0.60 - 5.00
>=100 Piece
Meo Textile Clothing Co.LTD
Fitness Weight Lifting Adjustable KettlebellUSD $ 30.00 - 48.00
>=10 Piece
Meo Electronic Technology Co.LTD
Wholesale Strength Training Weight Lifting BarUSD $ 11.80 - 17.80
>=20 Piece
Meo Electronic Technology Co.LTD
Chrome Neoprene Coated Plating Mancuer Weight Lifting Dumbbel Haltere Musculation DumbbellUSD $ 0.96 - 1.30
>=500 Kilogram
Meo Electronic Technology Co.LTD
Sweat Weight Loss Belt Waist Trimmer Belly Fat Slimming Belt Leg Trainer Hip LiftingUSD $ 3.90 - 4.20
>=5 Piece
Meo Electronic Technology Co.LTD
Fitness anti - slip magnesium powder Magnesium carbonate The best price Weight lifting gymnastics Rock climbing powerliftingUSD $ 1.00 - 5.00
>=10 Unit
Meo Electronic Technology Co.LTD
lifting weights dummbells Barbell Neoprene Dumbbell Hand Weights, Anti-Slip, Anti-roll, 10kg dumbbell setUSD $ 1.65 - 1.65
>=10 Piece
Meo Electronic Technology Co.LTD
Sports protective weight lifting elastic custom lower back waist trimmer neoprene waist support beltUSD $ 4.10 - 4.10
>=50 Piece
Meo Electronic Technology Co.LTD
Free Sample Weight Lifting Belts Gym Powerlifting Wrist Wraps for FitnessUSD $ 0.90 - 2.50
>=200 Pair
Meo Electronic Technology Co.LTD
Leather Custom Nantong Weight Lifting BeltUSD $ 9.05 - 14.29
>=2 Piece
Meo Electronic Technology Co.LTD
Custom Logo Fitness Weightlifting Training Adjustable Neoprene Gym Weight Lifting Belt for SaleUSD $ 2.10 - 2.50
>=1 piec
Meo Electronic Technology Co.LTD
Exercise Bodybuilding Neoprene Weight Lifting Belt for Gym FitnessUSD $ 2.39 - 2.99
>=25 Piece
Meo Electronic Technology Co.LTD
Fitness Neoprene weight lifting Gym belt Padded Back Support Straps Wraps neoprene training beltUSD $ 3.50 - 4.20
>=100 Piece
Meo Electronic Technology Co.LTD
Bodybuilding Sport Workout Weight Lifting Neoprene Gloves Palm Protection beltUSD $ 4.70 - 4.70
>=100 Pair
Meo Electronic Technology Co.LTD
High Quality Gym Belt Custom Logo Back Support Fitness Bodybuilding Leather Weight Lifting Belt Hot Sweat BeltUSD $ 8.00 - 26.00
>=20 Piece
Meo Electronic Technology Co.LTD
MOQ 1000KG MOQ 1000KG Custom weight lifting belt fitnessUSD $ 5.00 - 50.00
>=1 Piece
Meo Electronic Technology Co.LTD
2021 Best Seller ladies Crossfit belts hot Seller Latest Designs Digital sublimationUSD $ 3.99 - 5.99
>=100 piec
Meo Electronic Technology Co.LTD
Hot Sale GYM POWER Powerlifting Belt - 13mm Lever Weight Belt - 4-inch Wide - Heavy Duty for ExtremeUSD $ 10.00 - 12.00
>=50 Set
Meo Electronic Technology Co.LTD
Black Sequence Women Gym Training Belt, Ladies Back Support Neoprene Weight Lifting Belt, Squats BeltUSD $ 4.50 - 5.50
>=100 Pair
Meo Electronic Technology Co.LTD
Best Quality Custom 10mm Thickness Lever Buckle Weight Lifting BeltUSD $ 8.15 - 20.50
>=200 piec
Meo Electronic Technology Co.LTD
neoprene nylon weight lifting gym back support training belt for men and womenUSD $ 2.25 - 3.95
>=20 Piece
Meo Electronic Technology Co.LTD
Fitness Weightlifting for Fitness Training Waist Support Building Strength Back Weight Lifting BeltUSD $ 3.53 - 4.61
>=10 Piece
Meo Electronic Technology Co.LTD
Gym Weight lifting Belt Pink Camo Body Building Fitness Exercise Training Back Support Neoprene BeltUSD $ 2.50 - 3.25
>=50 Piece
Meo Electronic Technology Co.LTD
Gym Fitness Heavy Duty Leather Weight Lifting BeltUSD $ 11.00 - 13.00
>=50 Piece
Meo Electronic Technology Co.LTD
Dipping Belt For Bodybuilding And Weight Lifting - Dip And Pull Up Weight Dip Lifting Chain NeopreneUSD $ 2.00 - 3.00
>=20 Piece
Meo Electronic Technology Co.LTD
Custom Womens Gym Health Waist Losing Neoprene Weight Lifting BeltsUSD $ 12.00 - 24.00
>=1 Piece
Meo Electronic Technology Co.LTD
Premium Leather Weight Lifting Training Power Lifting Belt gym belt Weight Lifting Double Gym Fitness Exercise BeltUSD $ 3.00 - 5.50
>=50 Piece
Meo Electronic Technology Co.LTD
Custom Logo Infinitely variable Adjustment Powerlifting Belt Gym Fitness Power LiftingUSD $ 83.50 - 89.50
>=1 Piece
Meo Electronic Technology Co.LTD
Custom women neoprene dipping weight lifting beltUSD $ 2.00 - 5.00
>=10 Piece
Meo Electronic Technology Co.LTD
Weight Lifting neoprene Belt gym training beltsUSD $ 3.50 - 5.00
>=50 Piece
Meo Electronic Technology Co.LTD
6 inch Wide Sublimated Printed Design Neoprene Weight Lifting Gym Workout Crossfit WOD BeltUSD $ 2.35 - 3.85
>=50 Piece
Meo Electronic Technology Co.LTD
GAF 2021 Bodybuilding Neoprene Weight Lifting Belt With Back SupportUSD $ 3.99 - 6.99
>=100 Piece
Meo Electronic Technology Co.LTD
Fitness Weight Lifting Belt Barbell Dumbbel Training Back Support Weightlifting Belt Gym Powerlifting WaistUSD $ 3.80 - 4.30
>=1 Piece
Meo Electronic Technology Co.LTD
Gym Custom Fitness Weight Lifting Belts Weight Lfiting PVC Rubber Logo / Woven Logo or Customized Custom Brands Leather PolybagUSD $ 2.80 - 3.20
>=50 Piece
Meo Electronic Technology Co.LTD
Free Sample Pakistan Factory Custom Weight Lifting Training Neoprene Waist Trimmer Belt With OEMUSD $ 4.25 - 8.25
>=25 Piece
Meo Electronic Technology Co.LTD
Neoprene Fitness Back Support Gym Weight Lifting BeltUSD $ 35.00 - 39.00
>=1 Piece
Meo Electronic Technology Co.LTD
Workout Fit Cross Strength Lifting And Gym Weight Training Durable Camo Fitness Exercise Neoprene Weightlifting Neoprene BeltUSD $ 6.58 - 6.96
>=20 piec
Meo Electronic Technology Co.LTD
Adjustable Fitness squat belt gym professional men and women weightlifting strength training bodybuilding beltUSD $ 6.69 - 7.29
>=1 Pair
Meo Electronic Technology Co.LTD
Weightlifting Dip Belt With Chain for Weighted Lifting Tricep Dips and Pull UpsUSD $ 4.00 - 5.25
>=50 Piece
Meo Electronic Technology Co.LTD
Weight Lifting Gym Exercise Neoprene Dipping Belt with Heavy ChainUSD $ 4.56 - 6.50
>=1 Piece
Meo Electronic Technology Co.LTD
Dumble Rode Self-locking Gym Physical Exercise Weight Lifting Neoprene BeltUSD $ 1.80 - 3.20
>=1 Piece
Meo Electronic Technology Co.LTD
Best quality Cow Hide Leather Weight Lifting Belt Back Support Strap Gym Power Training Weightlifting Width 11cm by x fitimpexUSD $ 2.10 - 3.10
>=1 Piece
Meo Electronic Technology Co.LTD
hot sale factory wholesale Custom Gym Power Weight Lifting Belt Body Building Gym Back Support Neoprene BeltsUSD $ 2.95 - 5.99
>=25 Pair
Meo Electronic Technology Co.LTD
Professional Custom Logo Weight Lifting Power Lever Dipping Chain Padded Leather Gym BeltsUSD $ 6.50 - 17.00
>=100 Piece
Meo Electronic Technology Co.LTD
Custom Logo Fitness Weightlifting Training Adjustable Neoprene Gym Weight Lifting Belts for SaleUSD $ 4.55 - 6.55
>=50 Piece
Homelife
Neoprene Weightlifting Dip Belt with Chain for Heavy Training WorkoutUSD $ 3.00 - 5.50
>=100 Piece
Meo Electronic Technology Co.LTDRelated Searches:
gripstrapsforliftingbestworkoutglovesweighttrainingbeltgold'sgymworkoutglovesrdxstrapsliftinggripsrogueweightliftingbeltweightliftingsystemgold'sgymweightliftingglovesweightliftingforwomen'sfatlossweightbeltsforsaleweightliftinghooksweighteddipbeltbodyweighttrainingforweightlossweightsforweightlossbestdeadliftstrapsweighttrainingprogramforwomenjustliftbeltsimpleweighttraininggymweightliftingglovescustompowerliftingbeltsweightliftingbenchsetweightliftingworkoutfatburningweightliftingweightliftinglogpowerliftingforweightlossdeadliftglovesweightliftingglovessportsdirectweightliftingbarolympicweightliftingplates