Welcome to TradeChina
RELATED CATEGORIES:
OEM Spa Treatment Washing Foam Face Light Japanese Skin Care SetUSD $ 17.50 - 37.00
>=1 Piece
Meo Food Co., Ltd.
Wholesale bath gift set for men bath body shower gel face wash moisturiser face care men bath set cosmetic bag Father's DayUSD $ 2.39 - 2.67
>=500 Set
Meo Food Co., Ltd.
2021 private label skin care men face wash scrub moisturizer men skin care setUSD $ 6.18 - 6.23
>=2000 piec
Meo Food Co., Ltd.
Professional Tranexamic Acid Skin Care Big Set-- 8 Days Skin Whitening Brightening Face Serum for Men & WomenUSD $ 40.00 - 45.00
>=1 Box(es)
Meo Food Co., Ltd.
OEM Men's Skin Care Set Oil-control Mousse Foam Cleanser Whitening Face Cream Moisturizing Face Washing Care Men SetUSD $ 2.34 - 2.43
>=1 Set
Meo Food Co., Ltd.
Daily Care Deep Facial Cleansing Exfoliating Private Label Organic Face Scrub Face Wash For ManUSD $ 5.46 - 6.25
>=1000 Set
Meo Food Co., Ltd.
Natural Face&Body Wash Exfoliating Face Scrub and Anti Aging Face Moisturizing Mens Skin Care Set private labelUSD $ 4.99 - 5.95
>=1000 Box(es)
Meo Food Co., Ltd.
Private Label 3 in 1 Facial Cleanser Men's Skin Care Oil-control Cleansing Face Wash SetUSD $ 1.09 - 2.00
>=3000 Piece
Meo Food Co., Ltd.
Oil Control Brightening Face Wash 120ml Slyncare Organic Facial Cleanser Men Face Skin Care SetUSD $ 2.79 - 3.39
>=1 piec
Meo Food Co., Ltd.
Wholesale Private Label Men Face Cleanser Whitening Men's Face WashUSD $ 0.81 - 0.82
>=100 Piece
Meo Food Co., Ltd.
Men Skin Care Set Amino Acid Facial Cleanser Best Natural Acne Deep Clean Face Wash Private Label For Men Oily SkinUSD $ 1.00 - 1.33
>=10 Piece
Meo Food Co., Ltd.
Wholesale Sea Salt Face Wash Bamboo charcoal Men Facial CleanserUSD $ 1.83 - 3.77
>=1 Piece
Meo Food Co., Ltd.
Cosmetic Oem Man Best Acne Face Wash Vitamin C Whiten Facial CleanserUSD $ 1.50 - 2.80
>=120 piec
Meo Food Co., Ltd.
Private Label Skin Care Deep Clean Whitenning Face Wash Organic Mens Facial CleanserUSD $ 1.10 - 1.20
>=10 Piece
Meo Food Co., Ltd.
Top Personal Care Manufacturer Mens Skincare Set Facial Cleanser Face Wash MenUSD $ 2.78 - 3.29
>=1 piec
Meo Food Co., Ltd.
Odm/Oem Wholesale Customized Brand Cooling Face Wash And After Shave Cream In Toiletry Bag For MenUSD $ 3.00 - 3.00
>=1000 piec
Meo Food Co., Ltd.
OEM Factory In Stock Private label Oil Control Facial Cleanser Wholesale Deep Cleansing Cool Face Cleanser Facial For ManUSD $ 0.72 - 0.92
>=96 piec
Meo Food Co., Ltd.
OEM Men's Skin Care Set Oil-control Mousse Foam Cleanser Whitening Face Cream Moisturizing Private Label Face Wash SetUSD $ 1.09 - 2.85
>=10 Piece
Meo Food Co., Ltd.
Wholesale Moisturizer Face Skin Care For Men Face Wash Hydrating Toner Nourishing Cream Seaweed Oil Control Men Skincare SetUSD $ 2.71 - 2.73
>=10 Set
Meo Food Co., Ltd.
Best Whitening Anti-aging Face Cream Face Wash Face Lotion Men Skin Care Set by truffle extractUSD $ 7.50 - 15.00
>=500 Set
Meo Food Co., Ltd.
Herbal Whiten Shower Shampoo Gel Man Face Wash Cleanser Facial Cream gift setUSD $ 1.71 - 1.73
>=3000 Piece
Meo Food Co., Ltd.
OEM Private Logo Custom Natural Organic Bath Soap Face Wash Skin Care Set Luxury Black Wedding Gifts For Men Facial Spa Gift SetUSD $ 3.90 - 5.95
>=1000 Unit
Meo Food Co., Ltd.
Alcohol-free Herbal Spray Toner Face Wash Skincare Kit organic private label men Trio skin care setUSD $ 5.00 - 15.00
>=15 Set
Meo Food Co., Ltd.
Private Label OEM/ODM Skin Care Mens Face Wash Spray Toner Moisturizer Skincare Men Organic Men Skin Care setUSD $ 2.00 - 2.80
>=1000 Set
Meo Food Co., Ltd.
OEM Korea Skin Care Men Face Wash Spray Toner Moisturizer Skincare Men Kit Organic Men Skin Care SetUSD $ 10.50 - 12.56
>=99 Box(es)
Meo Food Co., Ltd.
best price face wash man care gift set for 100% nature beard oilUSD $ 0.50 - 3.00
>=1000 Set
Meo Food Co., Ltd.
Private Label OEM Professional Alcohol-free Herbal Spray Toner Face Wash Skin Care Kit Men Skin Care SetUSD $ 1.90 - 3.19
>=1000 piec
Meo Food Co., Ltd.
Cotton plain men and women home washs a face towels discontinuity towelsUSD $ 0.19 - 0.39
>=500 Pack
Meo Food Co., Ltd.
Professional hotel supplies Men Cologne shampoo Shower Gel face wash setUSD $ 7.60 - 8.50
>=1 Set
Meo Food Co., Ltd.
Private Label Oil Control Anti-Acne Face Wash Cleanser Men Skin Care SetUSD $ 5.10 - 8.10
>=1000 Set
Meo Food Co., Ltd.
Valentine's Day Envisha private label custom vegan shave oil face wash balm men skin care setUSD $ 3.20 - 3.80
>=2 piec
Meo Food Co., Ltd.
Men Beauty Salon Skin Care Products Moisturizer Whitening Cream Face Wash Serum 3 In 1 Skin Care SetUSD $ 7.60 - 8.00
>=100 Set
Meo Food Co., Ltd.
3 Pcs Professional Private label Caremoisturizing Toner Face Wash Skin Care Acne organic Skin Care Set For MenUSD $ 3.65 - 4.20
>=2 boxe
Meo Food Co., Ltd.
Men's Skin Care Set (3 Piece) Grooming Gift Set to Wash, Moisturize Daily; Gift for Men Ingredients Fruit Organic Vegan HerbalUSD $ 5.80 - 7.50
>=200 piec
Meo Food Co., Ltd.
Natural Face Hair Growth and Smooth Beard Wash Shampoo and Conditioner SetUSD $ 2.95 - 3.61
>=10 piec
Meo Food Co., Ltd.
Isner Mile perfect care gift set valentine's day for man cleanse beard and face moisturizes washUSD $ 1.70 - 2.50
>=50 piec
Meo Food Co., Ltd.
hair health and beauty extensions great face wash basic makeup brush set best face brush for menUSD $ 8.20 - 8.60
>=100 piec
Meo Food Co., Ltd.
Paper Box Bath Gift Set for Men Face Wash Beard Shampoo and Body WashUSD $ 2.50 - 3.00
>=1000 Set
Meo Food Co., Ltd.
Wholesale Price Men's fleece modern fit sweat suit pants hoodie men tracksuit SetUSD $ 9.25 - 12.00
>=25 piec
Meo Electronic Technology Co.LTD
Amovol 2021 Sonic Face Cleansing Brush With Waterproof Facial Cleansing Spin Brush SetUSD $ 1.10 - 2.10
>=10 Set
Meo Food Co., Ltd.
Laciani - Italian Skincare Gift Set Men Grooming (ISO, Herbal)USD $ 1.20 - 309.90
>=500 Unit
Meo Food Co., Ltd.
Face Cleaning Scrub Wash Flutter Bathroom Accessories Towel Exfoliator Skin Deep Washing Massage Dropshipping Loofah SpongeUSD $ 0.22 - 0.72
>=100 piec
Meo Food Co., Ltd.
Portable Men Shaving Machine Electric Men Shaver, Electric Shaver SetUSD $ 5.23 - 6.92
>=2 Piece
Meo Food Co., Ltd.
Hot Sale Private Label Mens Skincare Products OEM Korean Cosmetics Men Personal Care Acne Anti Aging Skin Care Set for MenUSD $ 3.50 - 4.30
>=1 Set
Meo Food Co., Ltd.
OEM Private Label skin care men volcanic mud oil control refreshing acne three - piece set moisturizing facial cleanser setUSD $ 3.11 - 3.89
>=10 Set
Meo Food Co., Ltd.
2019 wholesales face care moisture spa wash lotion shower gel bath and body works gift set for menUSD $ 3.80 - 4.30
>=2000 Set
Meo Food Co., Ltd.
Hot Sale New Style Cordless Man Electric Hair Shaver SetUSD $ 5.59 - 7.99
>=40 Piece
Meo Food Co., Ltd.Related Searches:
ohuiskincaresethadalaboskincaresetsensitiveskingiftsetbestfacialsetforoilyskinskincaresetforsensitiveskinneutrogenaskincaresetatomyskincaresetdralvincreamskincarebrushsetmen'sfacecaresetskinbrighteningsetmarykaytimewiserepaircleanserkoreanskinrejuvenatingsetjigottsnailsetbestskincaresetformeninnisfreegreenteabalancingsetatomytravelkitcetaphilsetskincarekoreanskincaresetforacnerejuvenatingsetbydralvinwholesalebestskincaresets2017cleansertonerandmoisturisersetbioaquaaloeverasetjejuorchidskincaresetinnisfreejejuorchidskincaresetantiwrinklesetfacialtreatmentsetabsoluteatomyskincareabsoluteskincareatomythefaceshopskincarestarterkit