Welcome to TradeChina
RELATED CATEGORIES:
Fashion custom rhinestone bead eye embroidery patches for clothingUSD $ 0.50 - 0.90
>=100 Piece
Meo Electronic Technology Co.LTD
Hot Selling New Design Custom Patch Bling Large Heart Eye Embroidered Sequin Patch For Clothing Patches DIYUSD $ 0.15 - 0.60
>=100 Piece
Meo Electronic Technology Co.LTD
greatful dead patches chinese embroidery jacket women evil eye rhinestone appliqueUSD $ 0.68 - 0.85
>=10 Piece
Meo Electronic Technology Co.LTD
Hot sale Evil Eye Patch oem Iron On Embroidered Applique custom logo patch embroidery cap patchUSD $ 0.10 - 2.50
>=100 Piece
Meo Electronic Technology Co.LTD
13.4*12.3cm,embroidery eyes patch,iron on evil eyes sequins patch appliques ZK-19122016USD $ 0.35 - 0.65
>=50 Piece
Meo Electronic Technology Co.LTD
Hot Sale Bulk Stock Sequin Evil Eyes Patches Iron On PatchUSD $ 0.30 - 0.70
>=500 Piece
Meo Electronic Technology Co.LTD
Factory directly customized shipment of evil rainbow eye puffer clothing ironing sequins patchesUSD $ 0.32 - 0.64
>=10 Piece
Meo Electronic Technology Co.LTD
Fabric Embroidered Factory Custom Witch Spangle Sequin Patch Embroidery Appliques Magic Evil Eye Patches For GarmentUSD $ 0.17 - 0.79
>=500 Piece
Meo Electronic Technology Co.LTD
Love Large Sequin Heart Evil Eyes Patch No Glue Cartoon Motif Applique Embroidery Garment AccessoryUSD $ 1.39 - 1.99
>=100 Piece
Meo Electronic Technology Co.LTD
Hot sale Large Evil Eye Patch Kids sequin patches for clothing Iron On Embroidered Applique custom patches for t shirtsUSD $ 0.48 - 0.68
>=20 Piece
Meo Electronic Technology Co.LTD
Heat transfer chenille iron on woven patch custom ons rainbow big evil eye high quality embroidery patch for clothing appliqueUSD $ 0.22 - 0.85
>=10 Piece
Meo Electronic Technology Co.LTD
Hot sale Large Evil Eye Patch Kids sequin patches for clothing Iron On Embroidered Applique custom patches for t shirtsUSD $ 0.48 - 0.68
>=20 Piece
Meo Electronic Technology Co.LTD
Adhesive Applique Embroidery Patches Large Size Evil Eyes Sequin Patch for ClothingUSD $ 0.83 - 1.10
>=20 Piece
Meo Electronic Technology Co.LTD
Adhesive Applique Embroidery Patches Large Size Evil Eyes Sequin Patch for ClothingUSD $ 0.83 - 1.10
>=20 Piece
Meo Electronic Technology Co.LTDsilk flower patch embroidery military screw on appliqueUSD $ 0.68 - 0.85
>=10 Piece
Meo Electronic Technology Co.LTDRelated Searches:
eyepatchtreatmenteyepatchforkidscooleyepatchesplasticeyepatchhighqualityeyepatchpirateeyecoverpiratepatchforlazyeyenoveltyeyepatcheseyeballeyepatchfashioneyepatchsmalleyepatchforadultseyepatchforadultsoneeyepatchcuteeyepatchesforadultsskincoloredeyepatchfrozeneyepatchpersonalizedeyepatchespirateeyepatchesbulkbuypirateeyepatcheyepatchforlazyeyeeyepadforkidsbutterflyeyepatchawesomeeyepatcheskidseyepatcheseyepatchforrighteyechickeneyepatchdecorativeeyepatchrighteyepatcheyepatchtherapyflateyepatch