Welcome to TradeChina
RELATED CATEGORIES:
Fashion Design Custom Chiffon Flower Mesh Polyester Baby Blanket African Embroidery Sequins Patches Fabric Scarf With Lace 2021USD $ 5.50 - 6.50
>=5 Yard
Meo Electronic Technology Co.LTD
Best Selling Beads Sequin Fabric French Style Lace Embroidery Elegant Decent Wedding Dress GarmentsUSD $ 7.60 - 8.00
>=500 Yard
Meo Electronic Technology Co.LTD
100% polyester gold Silk jacquard with metallic lurex chiffion fabric for lady's dress shirt blouseUSD $ 1.33 - 1.36
>=1000 Yard
Meo Electronic Technology Co.LTD
recycled fabric ready goods in-stock woven polyester embroidery fabric for garmentUSD $ 2.65 - 2.65
>=1000 Meter
Meo Electronic Technology Co.LTD
High grade black indian gold sequin embroidery velvet fabric for curtainUSD $ 3.50 - 10.00
>=1 Meter
Meo Electronic Technology Co.LTD
Women Clothing Flower Embroidery Rose Gold Black Sequin FabricUSD $ 5.50 - 6.00
>=200 Yard
Meo Electronic Technology Co.LTD
Multicolor 2020 Wholesale Embroidery Black Mesh Tulle Lace Gold Sequin Fabric For DressUSD $ 6.00 - 6.90
>=200 Meter
Meo Electronic Technology Co.LTD
Chinese factory Cotton Eyelet Embroidery Lace Fabric For Dresses Women Lady ClothingUSD $ 2.85 - 3.50
>=5 Yard
Meo Electronic Technology Co.LTD
Hot selling 100% polyester black and gold sequins embroidery net fabricUSD $ 5.80 - 5.80
>=10 Yard
Meo Electronic Technology Co.LTD
Latest High Quality 100% Cotton African Bridal Embroidery Traditional big Wedding Swiss Voile lace fabricUSD $ 24.50 - 24.50
>=1 Piece
Meo Electronic Technology Co.LTD
CRF0430B fashion cushion fabric flash order Silver gold mesh reversible sequin fabricUSD $ 2.70 - 4.89
>=40 Meter
Meo Electronic Technology Co.LTD
Blue Sequin Fabric Velvet Two Tone Lace Blush red Bridal Wholesale India Bronze Brown Plaid Mesh BurgundyUSD $ 4.35 - 8.50
>=20 Yard
Meo Electronic Technology Co.LTD
African bazin riche fabric dress with gold embroidery CL12-10 Guinea brocade fabric jacquard bazin tissu getzner fabricUSD $ 6.00 - 7.00
>=5 Yard
Homelife
Wholesale Custom High Quality Two Tone Reversible Magic Flip 4Way Stretch Satin Lace Net Embroidery Dress 5mm Gold Sequin FabricUSD $ 2.80 - 4.50
>=5 Yard
Homelife
Satin Polyester Damask Fabric Jacquard Brocade Fabric for Suit Garment ClothingUSD $ 1.90 - 2.80
>=5 Meter
Homelife
Classic embroidery tulle shiny 3mm sequin fabric for wedding decorationUSD $ 1.45 - 2.50
>=10 Yard
Homelife
2020 Qood quality Flag Green color taffeta fabric for evening and bridal dressUSD $ 2.80 - 2.80
>=1 Meter
Meo Electronic Technology Co.LTD
LN51203-4 Beautiful purple Hollow embroidery design african george lace fabric for womenUSD $ 5.00 - 9.00
>=5 Yard
Meo Electronic Technology Co.LTD
Superior quality flower embroidery mesh fabric polyester net fabric mesh printed stretch mesh fabricUSD $ 0.98 - 1.22
>=1 Yard
Meo Electronic Technology Co.LTD
Pure linen shirt striped garment fabric 184gsm weight thick stone washed linen jacquard embroidery DIY flax fiber napkin linenUSD $ 5.56 - 5.98
>=10 Meter
Meo Electronic Technology Co.LTD
2021 dubai french cloth wedding dress design green black lace mesh net textile flower 3D beaded embroidery tulle fabricUSD $ 1.52 - 1.85
>=200 Yard
Homelife
fancy maslin digital printed fabrics materials for girls ladies multi purpose use fabrics collection wholesaler of indiaUSD $ 2.00 - 3.00
>=1000 cubic meter
Meo Electronic Technology Co.LTD
custom embroidery 100% cotton double layers gauze muslin fabric, suitable for baby clothes, pajamas, breathable, softUSD $ 3.50 - 4.00
>=500 Meter
Homelife
2020 Top Quality Big Sequins Net Fabric New Design Embroidery Wedding Bride Or Bridesmaids Dress Sequined Tulle Lace MaterialsUSD $ 7.30 - 8.20
>=5 Yard
Meo Electronic Technology Co.LTD
Cheap price three layer 100% polyester ultrasonic quilted knitted upholstery furniture sofa fabricUSD $ 2.35 - 2.35
>=1000 Kilogram
Meo Electronic Technology Co.LTD
Top Sale French Lace Fabric Luxury Sequins Rose Flowers Embroidery Mesh Nigeria Wedding LaceUSD $ 6.84 - 7.65
>=5 Yard
Meo Electronic Technology Co.LTD
double net tulle dressing sequins organza lace handcut fabric embroideryUSD $ 11.90 - 11.90
>=5 Yard
Meo Electronic Technology Co.LTD
CRF0430 wholesale hot multi color spangle fabric sequin embroidery sequin rose gold fabricUSD $ 3.00 - 4.89
>=40 Meter
Meo Electronic Technology Co.LTD
2020 New Arrival Flower Embroidery Cotton Eyelet White Lace fabrics for dressUSD $ 1.90 - 2.10
>=5 Yard
Meo Electronic Technology Co.LTD
Professional tissu de maille de polyester hard stiff tulle fabric for wedding tutu dressUSD $ 0.22 - 0.30
>=2000 Meter
Meo Electronic Technology Co.LTD
2019 Wholesale New Grid Layout Multi Color Grey Embroidered Fabric Green glitter decorative embroidery reversible Sequin FabricUSD $ 3.80 - 4.00
>=50 Yard
Meo Electronic Technology Co.LTD
Promotional good quality chian mesh with embroidery multi colour fabric printed spandex mesh fabricUSD $ 0.70 - 0.87
>=1 Yard
Meo Electronic Technology Co.LTD
High quality Embroidery Eyelet Cotton Fabric for Ladies WearUSD $ 2.00 - 2.50
>=300 Kiloampere
Meo Electronic Technology Co.LTD
Chinese factory embroidery sequins net lace 3d fabric flower for aso ebi sun seeds-shaped gold sequin At Wholesale PriceUSD $ 3.66 - 6.30
>=1 Yard
Meo Electronic Technology Co.LTD
Gold color embroidery black fabric african lace trim ribbon fabricUSD $ 4.23 - 4.38
>=1 Piece
Meo Electronic Technology Co.LTD
Full repeat black gold pattern sequins embroidery poly mesh fabric for women garment bagUSD $ 10.50 - 13.00
>=1 Yard
Meo Electronic Technology Co.LTD
Custom High Quality Ottoman Fabric Gold 3D Embroidery Black Luxury Designer 5 Panel Baseball CapUSD $ 1.60 - 5.90
>=2 Piece
Meo Electronic Technology Co.LTD
Nigeria lace fabric embroidery beaded fabrics materials black color wedding african lacesUSD $ 4.90 - 6.20
>=5 Yard
Meo Electronic Technology Co.LTD
Gold korean stones beads embroidery lace luxury 3d flower tulle lace fabric with beadedUSD $ 5.90 - 5.90
>=5 Yard
Meo Electronic Technology Co.LTD
Custom Calico Cotton Fabric Drawstring Bag With LogoUSD $ 0.18 - 0.38
>=300 Piece
Meo household Co.LTD
Nigerian Lace Fabric Pink Color 2021 Embroidery African French Tulle Lace With Sequins and Beads For Women DressUSD $ 8.50 - 10.00
>=5 Yard
Meo Electronic Technology Co.LTD
New Jacquard Design Dress Black Fabric Twill Silk Stripe Metallic Fabric Lurex Tulle Fabric for Bag Wedding DressUSD $ 12.45 - 18.47
>=5 Meter
Meo Electronic Technology Co.LTD
Factory Supply Black Stainless Steel Scissors with Clear HandlesUSD $ 3.85 - 4.20
>=1 Piece
Meo Textile Clothing Co.LTD
Gold Applique Gold Patch Metallic Gold Appliques Iron on. Fine Embroidery in Mirrored Shape Perfect for NecklineUSD $ 1.81 - 3.00
>=1 Piece
Meo Electronic Technology Co.LTD
Style Knights Templar Past Commander Black & Gold Sword Belt Masonic regaliaUSD $ 1.00 - 20.00
>=5 Unit
Meo Electronic Technology Co.LTD
PS109 Embroidery Sequence African French Mesh Tulle Voile High Quality Nigerian Double Organza Sequins LaceUSD $ 9.00 - 9.50
>=5 Yard
Homelife
shidao french embroidery net high quality lace fabric with trimmingUSD $ 0.01 - 0.10
>=1 Yard
Meo Electronic Technology Co.LTD
Related Searches:
stainlesssteelcraftwiremetalquillingfinesilverwireforjewelrymakingsilverelectroformingjewelrymakinglargemetalcrochethooksminttincraftsmetalfoiltapecraftdokrametalcraftsaluminiumfoilartandcraftcorrugatedmetalforcraftsembroiderymetalsteelwireforjewelrymakingaluminumfoilembossingcraftmetalwirecraftsaluminumcraftstainlesssteelwireforjewelrymakingcheapsteelhorseshoesforcraftsdiymetalflowerscraftbendablecraftwirealuminiumfoilcraftsteelwireforcraftsbulksilverforjewelrymakinggoldcraftsilverfoiltapejewelrymakingmetalcraftingdiymetalcraftsbrassjewelrymakingmetalcrossstitchmetalstampingcraftsmetaltunisiancrochethooks