Welcome to TradeChina
Bioaqua Wholesale Anti-aging Whitening Nourishing Snail Skin Care Set 5 SetsUSD $ 6.00 - 9.00
>=1 Set
Meo Food Co., Ltd.
OEM/ODM BIOAQUA Horse Oil Skin Care 5 Sets For Face Care Nourishing Firming and Tender Skin care ProductsUSD $ 4.95 - 5.35
>=16 Set
Meo Food Co., Ltd.
wholesale bioaqua professional nourishing Moisturizing Snail skin care setUSD $ 5.97 - 5.97
>=16 Set
Meo Food Co., Ltd.
oem private label BIOAQUA moisturizing skin care product 24k gold skin care setUSD $ 5.78 - 5.80
>=16 Set
Meo Food Co., Ltd.
Bioaqua Blueberry moisturizing beauty cosmetic Skin Care SetUSD $ 3.97 - 3.97
>=20 Set
Meo Food Co., Ltd.
private label bioaqua aloe vera extract hydra skin care set nourishing moisturizing cosmeticUSD $ 4.43 - 4.43
>=16 Set
Meo Food Co., Ltd.
BIOAQUA Snail Lotion Anti Aging Moisturizing Hydrating Face Cream BB Cream Travel Skin Care Gift SetUSD $ 1.32 - 1.85
>=3 Set
Meo Food Co., Ltd.
5Pcs Bioaqua Snail Makeup Skin care Kits Moisturizing Hydrating Nourishing Oil Control Anti acne Serum Lotion Eye Cream SetUSD $ 1.73 - 1.83
>=6 piec
Meo Food Co., Ltd.
bioaqua blueberry anti-aging hydrating wonder moisturizing skin care setUSD $ 4.97 - 4.97
>=16 Set
Meo Food Co., Ltd.
bioaqua famous brand beauty product moisturizing skin care set for femaleUSD $ 2.45 - 9.79
>=16 Set
Meo Food Co., Ltd.
OEM ODM Bioaqua Silk protein Moisturezing natura product manufacturers skin care setUSD $ 1.91 - 7.64
>=16 Set
Meo Food Co., Ltd.
Bioaqua 24k Face Care Snail Set Moisturizing Whitening Cream Lotion Facial Face Day Cream Skin Care Korea Cosmetic Facial SetUSD $ 6.78 - 8.48
>=1 Set
Meo Food Co., Ltd.
OEM ODM Bioaqua Hyaluronic acid organic products private label skin care setUSD $ 2.65 - 10.59
>=16 Set
Meo Food Co., Ltd.
BIOAQUA moisturizing skin care product 24k gold skin care setUSD $ 11.94 - 11.94
>=16 Set
Meo Food Co., Ltd.
OEM BIOAQUA wholesale hydrating lightening 7piece/set skin care setUSD $ 2.97 - 6.97
>=16 Set
Meo Food Co., Ltd.
OEM ODM Bioaqua nourish is no greasy gold silk protein whitening skin care setUSD $ 1.20 - 4.78
>=48 Set
Meo Food Co., Ltd.
3 Pcs Professional Mens Skin Care Set Gift Series with Black Face Cleanser Men Toner and Face Moisturizing CreamUSD $ 3.29 - 3.49
>=30 piec
Meo Food Co., Ltd.
Oem Bioaqua Bioaqua Aloe Vera Whitening Skin Care Cleanser Skin Care Set For AcneUSD $ 6.00 - 9.00
>=1 Set
Meo Food Co., Ltd.
Wholesale Bioaqua Professional Beauty Cosmetics Skin Care Products Moisturizing Anti-Wrinkle Smoothing Firming SKin Care SetsUSD $ 4.45 - 8.90
>=20 Set
Meo Food Co., Ltd.
Wholesale hot sale bioaqua moisturizing whitening cosmetic setUSD $ 8.00 - 10.00
>=20 Set
Meo Food Co., Ltd.
OEM/ODM BIOAQUA Baby Muscle Skin Care 5 Sets For Face Care Tender Firming Moisturizing and Smooth Skin care productsUSD $ 4.38 - 4.75
>=16 Set
Meo Food Co., Ltd.
BIOAQUA factory new arrived private label natural mens skin care setUSD $ 2.96 - 2.96
>=24 Set
Meo Food Co., Ltd.
Customized bioaqua 6pcs beauty package contein serum face care cream lotion snail essence skin care setUSD $ 6.10 - 6.57
>=16 Set
Meo Food Co., Ltd.
OEM/ODM BIOAQUA Baby Muscle Skin Care 5 Sets For Face Care Firming Moisturizing FaceUSD $ 3.70 - 3.90
>=16 Set
Meo Food Co., Ltd.
SIAYZU OBO cosmetics oem oil control mousse foam cleanser face care moisturizing men skin care setUSD $ 2.63 - 2.63
>=48 Piece
Meo Food Co., Ltd.
Oem/odm Bioaqua Baby Muscle Skin Care For Face Care Tender Firming Moisturizing And Smooth Skin Care ProductsUSD $ 6.00 - 9.00
>=1 Set
Meo Food Co., Ltd.
private label Bioaqua 24k gold beauty skin care packaging sets lock water shrink pore lift skin firming skin care setUSD $ 5.78 - 6.88
>=16 Set
Meo Food Co., Ltd.
obo cosmetic BIOAQUA blueberry extract toner essence skin care setUSD $ 4.97 - 4.97
>=16 Set
Meo Food Co., Ltd.
Wholesale Natural Skin Care Serum Anti-aging/whitening/moisturing Blueberry Skin Care SetUSD $ 6.00 - 9.00
>=1 Set
Meo Food Co., Ltd.
OEM/ODM BIOAQUA snail extract moisturizinf nourishing face skin care setUSD $ 0.63 - 2.52
>=96 Set
Meo Food Co., Ltd.
Bioaqua Moisturizing Beauty Skin Care Cream Serum Anti-aging Skin Care Set for CosmeticUSD $ 9.86 - 14.60
>=5 Set
Meo Food Co., Ltd.
BIOAQUA private label skin+care+set foundation organic 24K gold oem anti aging moisturizing skin care setUSD $ 5.80 - 5.85
>=16 Set
Meo Food Co., Ltd.
Bioaqua 10pcs/set Moisturizing Hyaluronic Acid Serum Facial Skin Care Anti Wrinkle Anti Aging Collagen serum setUSD $ 1.65 - 1.95
>=30 piec
Meo Food Co., Ltd.
BIOAQUA three steps to blackhead skin care set blackhead export liquid nasal patch nasal membrane t zone care cosmeticsUSD $ 1.02 - 1.19
>=12 Set
Meo Food Co., Ltd.
BIOAQUA Anti Acne Shrink Pores Whitening Treatment Blackhead Scars Anti Acne Removal Gel Moisturizing Scar Face Care SetUSD $ 4.23 - 4.75
>=12 piec
Meo Food Co., Ltd.
Wholesale Bioaqua Images Organic Aloe Vera Plant Extract Moisturizing Mini Hand Lotion Cream Set For WinterUSD $ 0.78 - 0.98
>=20 Bag(s)
Meo Food Co., Ltd.
BIOAQUA Anti Aging Skin Whitening Care Moisturizing Hyaluronic Acid Double Function Nutrient Ampoule Essence Liquid SetUSD $ 1.85 - 2.50
>=24 Set
Meo Food Co., Ltd.
Bioaqua Natural face mask sheet deep moisturizing fresh fruit Blueberry facial face mask set for face careUSD $ 0.16 - 1.33
>=100 Piece
Meo Food Co., Ltd.
Wholesale Electric Personal Skin Care Microdermabrasion Blackhead Vacuum Suction Beauty Device for Acne,Pore Whitehead TreatmentUSD $ 7.00 - 15.00
>=5 Set
Meo Food Co., Ltd.
2019 BIOAQUA Skin Care Hyaluronic Acid Facial moisturizing Anti Wrinkle Aging Collagen SerumUSD $ 1.48 - 2.53
>=50 piec
Meo Food Co., Ltd.
OEM BIOAQUA olive set natural hair dye oil control care bottles shower gel hair conditioner shampooUSD $ 0.65 - 1.09
>=48 Piece
Meo Food Co., Ltd.
BIOAQUA Brand 100pcs/set High Quality Skin Care Makeup Cotton Wipes Makeup Tools Nail Polish Face Tips Removal Cotton PadsUSD $ 0.81 - 0.93
>=60 piec
Meo Food Co., Ltd.
Hot Sale Bioaqua Moisturizing Facial Cleanser Hydrate Snail Mild Moisturizing Snail Skin Care SetUSD $ 6.00 - 9.00
>=1 Set
Meo Food Co., Ltd.
Bioaqua private label 21days skin care serum set Anti-Aging Collagen facial serum setUSD $ 1.03 - 1.03
>=48 Box(es)
Meo Food Co., Ltd.
BIOAQUA 5 pcs/lot Plant flavor Hand Cream Set Moisturizing Hydra Moisturizing Nourishing Anti-chapping Whitening skin care setUSD $ 0.70 - 1.20
>=36 Set
Meo Food Co., Ltd.
Multi-flavor optional winter anti-drying gentle moisturizing hand skin care portable hand creamUSD $ 0.80 - 1.48
>=100 Set
Meo Food Co., Ltd.
BIOAQUA factory private label Beauty Professional Skin Care Anti Aging Whitening avocado skin care setUSD $ 0.39 - 4.60
>=16 Set
Meo Food Co., Ltd.
Wholesale New Best Bioaqua Hydrating Moisturizing 10*5ml Hyaluronic Acid B6 Serum SetUSD $ 1.65 - 1.95
>=30 Piece
Meo Food Co., Ltd.
Related Searches:
garnierskincaresetvlccantitanfacialkitsetof5antiwrinklesetjigottsnailessencemoistureskinbeautycaresetinnisfreebalancingsethadalaboskincaresetbestskincaresets2017rejuvenatingcreamdralvininnisfreegreenteabalancingsetbestfacialcleansersetjigottaloeaquabalanceskincareset3jigottessencemoistureskincare3setinnisfreejejuorchidskincaresetbestfacialsetforoilyskindralvinsetpriceskincaresetforsensitiveskinatomyeveningcare6setbestfacecaresetgoldenskincaresetskincarebrushsetatomytravelkitsetkitinnisfreeohuiskincaresetmen'sbodycaregiftsetsthefaceshopskincarestarterkitatomyantiagingsetcleansertonerandmoisturisersetetudemoistfullcollagensetbesttravelskincaresets