Welcome to TradeChina
Best skin cleanser clearing soap non drying non oily face wash for sensitive skinUSD $ 0.90 - 1.60
>=5000 Piece
Meo Food Co., Ltd.
Smart Face Wash Fairness Plus Spot Out best face wash for sensitive dry acne skinUSD $ 9.30 - 9.40
>=100 Dozen
Meo Food Co., Ltd.
Light Cleansing Mousse Daily Foaming Acne Face Wash Pimple Remover & Facial Pore Cleanser for Oily Skin Natural Skin CareUSD $ 1.80 - 2.60
>=100 Piece
Meo Food Co., Ltd.
Best Anti Acne Tea Tree Foaming Organic Face Cleanser Wash Private Label For Oily SkinUSD $ 2.20 - 6.00
>=12 Piece
Meo Food Co., Ltd.
Best Face Wash For Dry Skin Moisturizing Facial Pore CleanserUSD $ 1.90 - 5.00
>=12 Piece
Meo Food Co., Ltd.
Best Women Facial Bubble Foam For Dry Sensitive / face wash for womenUSD $ 1.42 - 1.65
>=3000 Piece
Meo Food Co., Ltd.
OEM factory organic face cleanser best face wash for oily skinUSD $ 0.61 - 0.67
>=500 Piece
Meo Food Co., Ltd.
best facial cleanser anti acne lavender cleansing lotion collagen face wash for dryskin whiting face cleanserUSD $ 2.85 - 4.05
>=50 Piece
Meo Food Co., Ltd.
OEM/ODM Best Onsen Liquid Face Wash For Acne Pimples SkinUSD $ 4.78 - 9.95
>=100 Kilogram
Meo Food Co., Ltd.
cleansing milk facial cleanser Foaming Face Wash Cream Cleanser For Sensitive SkinUSD $ 4.50 - 6.00
>=10 Piece
Meo Food Co., Ltd.
Hot wholesale selling facial cleanser deep cleansing whitening pigmentation best acne chinese face washUSD $ 2.50 - 9.00
>=12 Piece
Meo Food Co., Ltd.
MD Complexion Factor Exfoliating Cleanser (4 fl oz) | Acne Facial Cleaner Wash with 2.5% Benzoyl Peroxide | Cleanses Acne BacterUSD $ 10.00 - 10.00
>=12 Unit
Meo Food Co., Ltd.
100% Pure Scent Health Best NATURAL CLEANSING MILK FACIAL FOR SENSITIVE SKIN hydrating cleanser Skin wash women man SiberinaUSD $ 2.04 - 2.04
>=40 Piece
Meo Food Co., Ltd.
Anti Acne Face Gel Tonic Wash | Natural Product | Private Label | Wholesale | Bulk | Made in the EUUSD $ 4.62 - 4.86
>=200 Unit
Meo Food Co., Ltd.
Natural Best Acne Facial Cleansing Cream Face Wash For Oily SkinUSD $ 1.80 - 5.00
>=2 Piece
Meo Food Co., Ltd.
Private Label Oil Control Green Tea Wholesale Best Korean OEM Face Wash For Dry SkinUSD $ 1.90 - 5.00
>=12 Piece
Meo Food Co., Ltd.
lavender hydrosol facial pore cleanser lavender fragrance moisturizing facial cleanser best acne face washUSD $ 2.85 - 4.05
>=50 Piece
Meo Food Co., Ltd.
YANMEI Factory Purifying Charcoal Face Wash for Men oil control Facial Cleanser with Trehalose perlite activated carbon extractUSD $ 0.70 - 0.81
>=50 Piece
Meo Food Co., Ltd.
Korean Skin Care Tea Tree Best Face Wash for Oily Skin and Sensitive SkinUSD $ 1.90 - 5.00
>=12 Piece
Meo Food Co., Ltd.
Skin care soften smoothing face wash foaming facial cleanserUSD $ 1.19 - 1.29
>=5000 Piece
Meo Food Co., Ltd.
OEM best exfoliate amino acid hydrating pore cleansing facial foam cleanser for women and menUSD $ 0.90 - 2.50
>=5000 Piece
Meo Food Co., Ltd.
OEM/ODM natural herbal ingredient calendula Soothing Anti-Redness face wash gelUSD $ 4.73 - 6.39
>=100 Kilogram
Meo Food Co., Ltd.
Private Label Mens Organic Tea Tree Foaming Anti Acne Best Skin Whitening Face WashUSD $ 1.90 - 5.00
>=12 Piece
Meo Food Co., Ltd.
Best Medicated Pigmentation Mens Face Wash for Oily Skin Face CleanserUSD $ 1.90 - 5.00
>=12 Piece
Meo Food Co., Ltd.
Best Cleanser For Oily Skin Whitening Face Wash Make Up RemoverUSD $ 2.00 - 6.00
>=1000 Piece
Meo Food Co., Ltd.
Korean Green Tea Cleansing Foam Facial Cleanser OEM Lotion Best Face Wash for dry skinUSD $ 2.20 - 6.00
>=12 Piece
Meo Food Co., Ltd.
Sonic cleansing led oem set spin brushes for the face rechargeable face exfoliating electric facial brushUSD $ 3.28 - 4.65
>=2 Piece
Meo Food Co., Ltd.
Best vibration wash pink mini facial brushes facial cleansing brush massager cleaner exfoliating brush faceUSD $ 3.28 - 4.65
>=2 Piece
Meo Food Co., Ltd.
Acne Treatment Acne Face Wash Best Facial Cleanser For Men WholesaleUSD $ 2.50 - 5.00
>=12 Piece
Meo Food Co., Ltd.
apolomed best fiber laser face wash machine for sensitive dry acne scar removal skinUSD $ 5,000.00 - 22,500.00
>=1 Set
Meo Food Co., Ltd.
Facial anti wrinkle emulsion acne face cleanser gel mud mask cleaning solution for matured skinUSD $ 4.02 - 7.51
>=300 Piece
Meo Food Co., Ltd.
Best sensitive dry acne skin electric face cleansing brush, face wash brush, electric face exfoliatorUSD $ 4.45 - 7.28
>=30 Unit
Meo Food Co., Ltd.
Best Korean Vegan Organic Branded Oil Control Green Tea Face Wash For Acne WholesaleUSD $ 1.90 - 5.00
>=12 Piece
Meo Food Co., Ltd.
Korean Cosmetics Professional Skincare 150ML Face Cleanser Private Label Deep Cleansing & Refreshing Charcoal Men Face WashUSD $ 1.37 - 2.27
>=2 Piece
Meo Food Co., Ltd.
Facial Pore Cleanser Gentle Organic Wholesale Papaya Best Face Wash Cream for Oily SkinUSD $ 2.20 - 6.00
>=12 Piece
Meo Food Co., Ltd.
Wholesale Price Professional Skincare 90ML Oil Control & Deep Cleansing And Activated Charcoal Men Face WashUSD $ 0.77 - 1.57
>=2 Piece
Meo Food Co., Ltd.
Best Hydrating Vitamin C Milk Baby Face Wash Facial Aloe Organic Cleansing Foam Cleanser Private LabelUSD $ 2.20 - 6.00
>=12 Piece
Meo Food Co., Ltd.
Ginseng Papaya Herbal Best Anti Acne Whitening Private Label Face Wash CleanserUSD $ 2.20 - 6.00
>=12 Piece
Meo Food Co., Ltd.
Best Cleanser OEM Cleansing Foam Organic Tea Tree Facial Wash Private LabelUSD $ 2.20 - 6.00
>=12 Piece
Meo Food Co., Ltd.
Best Face Cleanser Wash Clay Mask Anti-acne Acne Pimple Cream Treatment SetUSD $ 5.40 - 9.00
>=12 Set
Meo Food Co., Ltd.
private label Best Vitamin C Face Wash Vegan Natural Organic Facial CleanserUSD $ 0.84 - 1.28
>=1000 Piece
Meo Food Co., Ltd.
private label Best Skincare Vitamin C Hydrating Facial Cleanser Face Deep Cleansing Gel wholesaleUSD $ 0.84 - 1.28
>=1000 Piece
Meo Food Co., Ltd.
Soy-Bean Milk Green Tea Cold Pressed Facial Cleansing Soap Men And Women Toilet Bath Soap Anti-Aging Anti-Wrinkles MoisturizingUSD $ 2.43 - 2.61
>=20 Piece
Meo Food Co., Ltd.
Bee honey with goat milk glutathione kojic acid best skin whitening organic natural handmade private label whitening soapUSD $ 1.30 - 1.30
>=1000 Piece
Meo Food Co., Ltd.
OEM Private Label Wholesale Organic CBD Soothing Anti Acne Relief Calming Scar Treatment Hemp Face Toner Hemp Acne Patch WaterUSD $ 1.80 - 3.90
>=10 piec
Meo Food Co., Ltd.
Related Searches:
rdlcleanserskinfacewashmedicatedfacewashkoreanfacewashniveafacialfoamsheamoisturefacewashdovefacialcleanserbestfacewashforacneanddryskinbestfacialcleansingbrush2018simplecleansingwipesneutrogenacleanserforoilyskinholikaholikaaloefacialcleansingfoamteatreefoamingfacewashbestfacialcleanserforoilyskincetaphilfacewashpricefacialcleansingoilhydratingfacewashtop5facewashfacewashfordryacneproneskineltamdfoamingfacialcleansermorningburstfacewashforacneproneskinbestmen'sfacewash2018moisturizingfacewashchemicalfreefacewashmildfacewashgentlefacecleanserbestcrueltyfreefacewashfacewashtopratedfacewash