Welcome to TradeChina
RELATED CATEGORIES:
Tomato, Vinegar, Food Portland Organic Ketchup 14 oz Gluten Free Non GMO VeganUSD $ 30.00 - 30.00
>=110 Unit
Meo Auto Parts Co.LTD
Japanese Boiled Instant Foods Noodles Vegan Health Japanese FoodUSD $ 1.50 - 4.00
>=20 Piece
Meo Auto Parts Co.LTD
spicy vegan snacks vegetarian substitutes mala snack bulk Chinese foodUSD $ 0.08 - 0.10
>=1 Pack
Meo Auto Parts Co.LTD
Japanese vegan food HALAL diet health food slim konjac foodUSD $ 0.30 - 0.50
>=3000 Bag(s)
Meo Auto Parts Co.LTD
Customize causal konjac vegan snack food low calorie Konjac hot pot taste snackUSD $ 0.12 - 0.18
>=1 Bag(s)
Meo Auto Parts Co.LTD
Low carb konjak reis gluten free dry konjac rice vegan foodUSD $ 0.70 - 1.00
>=1000 Bag(s)
Meo Auto Parts Co.LTD
Wholesale KOREA VEGAN FOOD Red TTEOK-BOKKI best food made in KOREAUSD $ 2.30 - 3.38
>=1 Piece
Meo Auto Parts Co.LTD
100% Vegan Halvah with Pistachio Halal halva 500grUSD $ 2.10 - 2.25
>=5000 Bag(s)
Meo Auto Parts Co.LTD
Gluten Free Keto Protein Bars Natural Ketogenic Toasted Coconut Vegan Low Carb Low SugarUSD $ 2.98 - 4.25
>=300 Bag(s)
Meo Auto Parts Co.LTD
Best Price Delicious Frozen Vegan Spring Roll For Fast Food 84 896674503USD $ 10.00 - 45.00
>=20 Carton(s)
Meo Auto Parts Co.LTD
Vegan Snack Pumpkin Seeds and Sesame Seaweed CrispsUSD $ 0.50 - 1.00
>=7200 Bag(s)
Meo Auto Parts Co.LTD
Vinegar, Food, Bulk, Bib Organic Bulk Portland Ketchup 2.5 Gallon Bag-n-Box Non GMOUSD $ 30.00 - 30.00
>=80 Unit
Meo Auto Parts Co.LTD
Lifeworth coconut vegan keto protein bars chocolateUSD $ 4.30 - 5.80
>=50 Bag(s)
Meo Auto Parts Co.LTD
GMP HACCP Hot Selling 100% Organic Healthy Vegan Protein Vegetarian Diet Plant-forward Soy Bean Vegan Meat SausageUSD $ 0.24 - 0.26
>=50000 piec
Meo Auto Parts Co.LTD
wholesale Chinese snacks spicy strip soybean products vegan meatUSD $ 3.40 - 3.56
>=500 Carton(s)
Meo Auto Parts Co.LTD
Soongan Anchovy Broth Vegan Made in Korea Food Natural freeze Drying Seafood Fish Soup Sauce Hot Soup Fish Seafood Dried SeafoodUSD $ 3.00 - 16.00
>=100 Box(es)
Meo Auto Parts Co.LTD
Healthy Postum Cocoa Blend 7 Ounces Made Of Roasted Wheat And Molasses Kosher Nongmo VeganUSD $ 6.25 - 6.25
>=2700 Unit
Meo Auto Parts Co.LTD
Processing konjac food japanese konjac konjac vegan for exportUSD $ 1.00 - 24.00
>=1 Piece
Meo Auto Parts Co.LTD
Chinese Snack Vegan Food Instant Food Vegetable Curry Samosa 15g With HalalUSD $ 13.00 - 20.00
>=1000 Carton(s)
Meo Auto Parts Co.LTD
Low carb dry konjak nudeln gluten free dried shirataki konjac noodles vegan foodUSD $ 2.30 - 2.50
>=1000 Bag(s)
Meo Auto Parts Co.LTD
KOREA VEGAN FOOD Red TTEOK-BOKKI best products made in KOREAUSD $ 2.30 - 3.38
>=1 Piece
Meo Auto Parts Co.LTD
TH Foods Honey Roasted Sesame Snack Sticks Ft 40 Lb. Bulk - Signature Recipe Made with Real Sesame and Honey. Great Crunch! USAUSD $ 1.66 - 1.66
>=1800 Pound
Meo Auto Parts Co.LTD
Halvah Tahini 100% Traditional Turkish Vegan Sesame Halva 500grUSD $ 1.11 - 1.22
>=5000 Bag(s)
Meo Auto Parts Co.LTD
Supplier Good Taste Vegan Prawn With Vegetarian Shrimp 84 896674503USD $ 0.11 - 0.16
>=50 Bag(s)
Meo Auto Parts Co.LTD
1 oz Amber & Rich Organic Maple Syrup By Maple Valley Cooperative 100% Vegan And Vegetarian FriendlyUSD $ 1.85 - 1.85
>=96 Unit
Meo Auto Parts Co.LTD
private label top quality natural health immune booster powder to enhance immunity system diabetes daily vegan supplementUSD $ 8.00 - 15.00
>=10 Bag(s)
Meo Auto Parts Co.LTD
Vegan foodie UNCUT plant-based burger savory chickenUSD $ 20.54 - 22.54
>=480 Case(s)
Meo Auto Parts Co.LTD
Nature's PRIME Shreds Best Quality Plant-based Protein - All Natural, Vegan, Non-GMO Project Verified, Gluten Free, Low FatUSD $ 5,000.00 - 5,000.00
>=1 palette
Meo Auto Parts Co.LTD
Japan Wholesale Otafuku Tonkatsu Fried Food Vegan Products Sauce DishUSD $ 1.80 - 2.30
>=120 Piece
Meo Auto Parts Co.LTD
Instant Postum Cocoa Blend instant beverage 7 Ounces Made Of Roasted Wheat And Molasses Kosher Nongmo VeganUSD $ 6.25 - 6.25
>=2700 Unit
Meo Auto Parts Co.LTD
Quality assurance konjac vegan food delicious tofu snack lower blood sugar organic chinese konjac tofuUSD $ 0.36 - 0.60
>=2 Carton(s)
Meo Auto Parts Co.LTD
Customized Japanese vegan food noodle organic konjac productsUSD $ 2.10 - 2.10
>=1 Piece
Meo Auto Parts Co.LTD
Japanese hot sale potoes organic vegan frozen food products for saleUSD $ 2.90 - 111.27
>=72 Piece
Meo Auto Parts Co.LTD
keto food konjac noodles spicy chicken noodles instant shirataki noodlesUSD $ 0.30 - 0.80
>=1000 Bag(s)
Meo Auto Parts Co.LTD
TH Foods Delicious Cajun Sesame Food Snack Sticks Ft 2 - 7.5 Lb. Bags - Goes Great as a Snack or with a Snack Mix! Great Crunch!USD $ 1.51 - 1.51
>=1350 lb
Meo Auto Parts Co.LTD
OEM organic buckwheat protein health meal replacement powder vegan cereal for diabetes Christmas giftUSD $ 5.50 - 8.00
>=96 Bag(s)
Meo Auto Parts Co.LTD
High Export Vegetarian Shrimp With Vegan Products In Vietnam 84 896674503USD $ 0.11 - 0.16
>=50 Bag(s)
Meo Auto Parts Co.LTD
BEST KOREA VEGAN halal loose weight FOOD black TTEOK-BOKKI made in KOREAUSD $ 2.30 - 3.38
>=1 Piece
Meo Auto Parts Co.LTD
Nature's PRIME Mini Pieces Best Quality Plant-based Protein - All Natural, Vegan, Non-GMO Project Verified, Gluten Free, Low FatUSD $ 6,500.00 - 6,500.00
>=1 palette
Meo Auto Parts Co.LTD
Healthy Low Calories Hot Sale Vietname Salad Seasoning Vegan Food Fish SauceUSD $ 7.00 - 7.50
>=300 Carton(s)
Meo Auto Parts Co.LTD
Sophisticated Organic Baked Pea Protein Crisps Kosher Vegan Herb 3.3 oz Offer New Twist On Beloved FavoriteUSD $ 22.08 - 24.77
>=1 Case(s)
Meo Auto Parts Co.LTD
Organic Grain Beverage Tasty Coffee Flavored Postum 8 Ounces Made Of Roasted Wheat And Molasses Kosher Nongmo VeganUSD $ 6.25 - 6.25
>=2700 Unit
Meo Auto Parts Co.LTD
Authentic Japanese Health Hot Plate Fried Sauce Products Vegan Food SeasoningUSD $ 2.60 - 3.10
>=120 Piece
Meo Auto Parts Co.LTD
The price of konjac vegan white konjac wet konjac has a light tasteUSD $ 1.00 - 24.00
>=1 Piece
Meo Auto Parts Co.LTD
Worcestershire, Condiments, Sauce Portland Organic Worcestershire Sauce 8 oz Organic VeganUSD $ 32.00 - 32.00
>=130 Unit
Meo Auto Parts Co.LTD
oem meal meat vegetarian spicy flavour healthy food ready to eat veganUSD $ 0.08 - 0.10
>=1 Pack
Meo Auto Parts Co.LTDRelated Searches:
veganwhitechocolatebargoodvegetariansnackssoybasedcheeseplantbasedjerkyvegansnackcakesamazingburgerveganmeatlessoptionshomemadeveganburgerveggelatinpowderspicyveggieburgerb12foodsvegetarianveganburgervegancheeseseitanwheatglutenveggieproductshomemadevegansnacksveganramenpacketssaltyvegansnackscadburyveganchocolateglutenfreeveganbreadmisopasteveganbestveganchocolateproteinpowderplantbasedchocolateplantbasedorganicproteinpowderultimateveganburgerglutenseitanglutenfreeveganchickennuggetstvpchickennuggetshighproteinveganpastaveganproductsonline